Amyloid beta-Protein (1-40) trifluoroacetate salt
CAS : 131438-79-4
Ref. 3D-FA108378
1mg | 740,00 € | ||
2mg | 1.221,00 € | ||
5mg | 2.624,00 € | ||
250µg | 340,00 € | ||
500µg | 497,00 € |
Informations sur le produit
- H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe- Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-G ly-Leu-Met-Val-Gly-Gly-Val-Val-OH H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-OH
- L-Valine,L-a-aspartyl-L-alanyl-L-a-glutamyl-L-phenylalanyl-L-arginyl-L-histidyl-L-a-aspartyl-L-serylglycyl-L-tyrosyl-L-a-glutamyl-L-valyl-L-histidyl-L-histidyl-L-glutaminyl-L-lysyl-L-leucyl-L-valyl-L-phenylalanyl-L-phenylalanyl-L-alanyl-L-a-glutamyl-L-a-aspartyl-L-valylglycyl-L-seryl-L-asparaginyl-L-lysylglycyl-L-alanyl-L-isoleucyl-L-isoleucylglycyl-L-leucyl-L-methionyl-L-valylglycylglycyl-L-valyl-
- Amyloidb-peptide(1-40)(human)
- H-asp-ala-glu-phe-gly-his-asp-ser-gly-phe-glu-val-arg-his-asp-ser-gly-phe-glu-val-arg-his-gln-lys-leu-val-gly-phe-phe-ala-glu-asp-val-gly-ser-asn-lys-gly-ala-ile-ile-gly-leu-met-val-gly-gly-val-val-oh
- ss-Amyloid (1-40), rat
- Beta-Amyloid Protein(1-40)
- Beta-Amyloid 1-40,human
- Abeta 1-40
- β-Amyloid(1-40)Human
Amyloid beta-protein (Aβ) is a protein that is involved in the metabolic processes that are thought to be associated with Alzheimer's disease. Aβ is a peptide of 39-43 residues and is found in amyloid plaques, which are aggregates of Aβ. The amino acid sequence of human Aβ has been determined by sequencing the cDNA and gene for this protein. The structure of the protein has been studied using molecular modeling, kinetic data, and predictive biomarker studies. Cleavage products have been identified from the protein, including beta-amyloid peptide (1-40), which can be used as a diagnostic marker for Alzheimer's disease. Structural analysis has also shown lysine residues that may serve as pharmaceutical targets for therapeutic intervention.
Propriétés chimiques
Question d’ordre technique sur : 3D-FA108378 Amyloid beta-Protein (1-40) trifluoroacetate salt
Si vous souhaitez demander un devis ou passer commande, veuillez plutôt ajouter les produits souhaités à votre panier, puis demander un devis ou passer commande à partir de votre panier. C'est une méthode plus rapide, plus économique, et vous pourrez bénéficier des remises disponibles ainsi que d'autres avantages