
(D-Ala2)-GRF (1-29) amide (human)
CAS :
Ref. 3D-FA109070

- Amides
- Enzyme, Peptide and Protein Related Compounds
- Amino Acids (AA)
- Peptides
- Biochemicals and Reagents
Informations sur le produit
Nom:(D-Ala2)-GRF (1-29) amide (human)
Synonymes :
- H-Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2 H-Y(dA) DAIFTNSYRKVLGQLSARKLLQDIMSR-NH2
Marque:Biosynth
Description :Please enquire for more information about (D-Ala2)-GRF (1-29) amide (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page
Avis:Nos produits sont destinés uniquement à un usage en laboratoire. Pour tout autre usage, veuillez nous contacter.
Propriétés chimiques
Masse moléculaire :3,357.88 g/mol
Formule :C149H246N44O42S
Degré de pureté :Min. 95%