Le produit a bien été ajouté au panier.

discount label
Amyloid beta-Protein (1-40) hydrochloride salt
Vue en 3D

Biosynth logo

Amyloid beta-Protein (1-40) hydrochloride salt

CAS : 131438-79-4

Ref. 3D-FA109545

1mg
669,00 €
2mg
1.029,00 €
5mg
2.249,00 €
250µg
265,00 €
500µg
437,00 €
Livraison estimée en/au États-Unis, le lundi 15 juillet 2024

Informations sur le produit

Nom :
Amyloid beta-Protein (1-40) hydrochloride salt
Synonymes :
  • H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala -Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-G ly-Leu-Met-Val-Gly-Gly-Val-Val-OH H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-OH
  • L-Valine,L-a-aspartyl-L-alanyl-L-a-glutamyl-L-phenylalanyl-L-arginyl-L-histidyl-L-a-aspartyl-L-serylglycyl-L-tyrosyl-L-a-glutamyl-L-valyl-L-histidyl-L-histidyl-L-glutaminyl-L-lysyl-L-leucyl-L-valyl-L-phenylalanyl-L-phenylalanyl-L-alanyl-L-a-glutamyl-L-a-aspartyl-L-valylglycyl-L-seryl-L-asparaginyl-L-lysylglycyl-L-alanyl-L-isoleucyl-L-isoleucylglycyl-L-leucyl-L-methionyl-L-valylglycylglycyl-L-valyl-
  • Amyloidb-peptide(1-40)(human)
  • H-asp-ala-glu-phe-gly-his-asp-ser-gly-phe-glu-val-arg-his-asp-ser-gly-phe-glu-val-arg-his-gln-lys-leu-val-gly-phe-phe-ala-glu-asp-val-gly-ser-asn-lys-gly-ala-ile-ile-gly-leu-met-val-gly-gly-val-val-oh
  • ss-Amyloid (1-40), rat
  • Beta-Amyloid Protein(1-40)
  • Beta-Amyloid 1-40,human
  • Abeta 1-40
  • β-Amyloid(1-40)Human
Description :

Amyloid beta-protein (1-40) hydrochloride salt H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln is a secretase inhibitor that binds to the active site of the enzyme and blocks its activity. Amyloid beta protein (1 - 40) hydrochloride salt H has been shown to inhibit the production of amyloid, which is linked to Alzheimer's disease. The amino acid sequence of this compound is identical to that of the human amyloid beta protein. The inhibition of enzymes such as aspartyl proteases, metalloproteases, and serine proteases may be responsible for its therapeutic effects in metabolic disorders.

Marque:
Biosynth
Stockage à long terme :
Notes :

Propriétés chimiques

Masse moléculaire :
4,329.81 g/mol
Formule :
C194H295N53O58S
Degré de pureté :
Min. 95%
MDL:
Point de fusion :
Point d'ébullition :
Point d'éclair :
Densité :
Concentration :
EINECS :
Merck :
Code SH :

Informations sur les risques

Numéro ONU :
EQ:
Classe :
Phrases R :
Phrases S :
Transport aérien interdit :
Informations sur les risques :
Groupe d'emballage :
LQ :

Question d’ordre technique sur : 3D-FA109545 Amyloid beta-Protein (1-40) hydrochloride salt

Veuillez plutôt utiliser le panier afin de demander un devis ou passer commande

Si vous souhaitez demander un devis ou passer commande, veuillez plutôt ajouter les produits souhaités à votre panier, puis demander un devis ou passer commande à partir de votre panier. C'est une méthode plus rapide, plus économique, et vous pourrez bénéficier des remises disponibles ainsi que d'autres avantages

* Champ obligatoire
Bienvenue chez CymitQuimica !Nous utilisons des cookies pour améliorer votre visite. Nous n’incluons pas de publicité.

Veuillez consulter notre Politique de Cookies pour plus de détails ou ajustez vos préférences dans "Configurer".