Amyloid beta/A4 Protein Precursor770 (740-770) trifluoroacetate salt
CAS : 1802086-24-3
Ref. 3D-FA109756
1mg | 470,00 € | ||
2mg | 717,00 € | ||
5mg | 1.286,00 € | ||
10mg | 2.249,00 € | ||
500µg | 279,00 € |
Informations sur le produit
- H-Ala-Ala-Val-Thr-Pro-Glu-Glu-Arg-His-Leu-Ser-Lys-Met-Gln-Gln-Asn-Gly-Tyr-Glu-Asn-Pro-Thr-Tyr-Lys-Phe-Phe-Glu-Gln-Met-Gln-Asn-OH H- AAVTPEERHLSKMQQNGYENPTYKFFEQMQN-OH
Please enquire for more information about Amyloid beta/A4 Protein Precursor770 (740-770) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Propriétés chimiques
Question d’ordre technique sur : 3D-FA109756 Amyloid beta/A4 Protein Precursor770 (740-770) trifluoroacetate salt
Si vous souhaitez demander un devis ou passer commande, veuillez plutôt ajouter les produits souhaités à votre panier, puis demander un devis ou passer commande à partir de votre panier. C'est une méthode plus rapide, plus économique, et vous pourrez bénéficier des remises disponibles ainsi que d'autres avantages