(Asn7)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS : 131438-79-4
Ref. 3D-FA110057
1mg | 490,00 € | ||
2mg | 820,00 € | ||
5mg | 1.500,00 € | ||
10mg | 2.678,00 € | ||
500µg | 343,00 € |
Informations sur le produit
- H-Asp-Ala-Glu-Phe-Arg-His-Asn-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe- Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-G ly-Leu-Met-Val-Gly-Gly-Val-Val-OH H-DAEFRHNSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-OH
- L-Valine,L-a-aspartyl-L-alanyl-L-a-glutamyl-L-phenylalanyl-L-arginyl-L-histidyl-L-a-aspartyl-L-serylglycyl-L-tyrosyl-L-a-glutamyl-L-valyl-L-histidyl-L-histidyl-L-glutaminyl-L-lysyl-L-leucyl-L-valyl-L-phenylalanyl-L-phenylalanyl-L-alanyl-L-a-glutamyl-L-a-aspartyl-L-valylglycyl-L-seryl-L-asparaginyl-L-lysylglycyl-L-alanyl-L-isoleucyl-L-isoleucylglycyl-L-leucyl-L-methionyl-L-valylglycylglycyl-L-valyl-
- Amyloidb-peptide(1-40)(human)
- H-asp-ala-glu-phe-gly-his-asp-ser-gly-phe-glu-val-arg-his-asp-ser-gly-phe-glu-val-arg-his-gln-lys-leu-val-gly-phe-phe-ala-glu-asp-val-gly-ser-asn-lys-gly-ala-ile-ile-gly-leu-met-val-gly-gly-val-val-oh
- ss-Amyloid (1-40), rat
- Beta-Amyloid Protein(1-40)
- Beta-Amyloid 1-40,human
- Abeta 1-40
- β-Amyloid(1-40)Human
(Asn7)-Amyloid b-Protein (1-40) trifluoroacetate salt H-Asp-Ala-Glu-Phe-Arg-His-Asn-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys
The product is a compound that has been shown to inhibit the formation of beta amyloid peptides in the brain. It binds to the beta amyloid peptide and prevents its aggregation, thereby preventing the formation of plaques and inhibiting neuronal cell death. The product contains no detectable levels of trehalose, which makes it ideal for use in brain imaging studies. This product may also be used as a predictive biomarker for Alzheimer's disease because it can be detected in cerebrospinal fluid and plasma.
Propriétés chimiques
Question d’ordre technique sur : 3D-FA110057 (Asn7)-Amyloid b-Protein (1-40) trifluoroacetate salt
Si vous souhaitez demander un devis ou passer commande, veuillez plutôt ajouter les produits souhaités à votre panier, puis demander un devis ou passer commande à partir de votre panier. C'est une méthode plus rapide, plus économique, et vous pourrez bénéficier des remises disponibles ainsi que d'autres avantages