(Asn7)-Amyloid b-Protein (1-40) trifluoroacetate salt

CAS : 131438-79-4

Ref. 3D-FA110057

Informations sur le produit

• Nom: (Asn7)-Amyloid b-Protein (1-40) trifluoroacetate salt
• Synonymes: H-Asp-Ala-Glu-Phe-Arg-His-Asn-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe- Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-G ly-Leu-Met-Val-Gly-Gly-Val-Val-OH H-DAEFRHNSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-OH
• Marque: Biosynth
• Description: (Asn7)-Amyloid b-Protein (1-40) trifluoroacetate salt H-Asp-Ala-Glu-Phe-Arg-His-Asn-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys; The product is a compound that has been shown to inhibit the formation of beta amyloid peptides in the brain. It binds to the beta amyloid peptide and prevents its aggregation, thereby preventing the formation of plaques and inhibiting neuronal cell death. The product contains no detectable levels of trehalose, which makes it ideal for use in brain imaging studies. This product may also be used as a predictive biomarker for Alzheimer's disease because it can be detected in cerebrospinal fluid and plasma.

Propriétés chimiques

• Masse moléculaire: 4,328.82 g/mol
• Formule: C₁₉₄H₂₉₆N₅₄O₅₇S
• Degré de pureté: Min. 95%