Amyloid beta-Protein (1-40) (scrambled) trifluoroacetate salt
CAS : 1678415-68-3
Ref. 3D-FA110091
1mg | 865,00 € | ||
2mg | 1.414,00 € | ||
100µg | 182,00 € | ||
250µg | 343,00 € | ||
500µg | 526,00 € |
Informations sur le produit
- H-Ala-Glu-Gly-Asp-Ser-His-Val-Leu-Lys-Glu-Gly-Ala-Tyr-Met-Glu-Ile-Phe- Asp-Val-Gln-Gly-His-Val-Phe-Gly-Gly-Lys-Ile-Phe-Arg-Val-Val-A sp-Leu-Gly-Ser-His-Asn-Val-Ala-OH H-AEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA-OH
Please enquire for more information about Amyloid beta-Protein (1-40) (scrambled) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Propriétés chimiques
Question d’ordre technique sur : 3D-FA110091 Amyloid beta-Protein (1-40) (scrambled) trifluoroacetate salt
Si vous souhaitez demander un devis ou passer commande, veuillez plutôt ajouter les produits souhaités à votre panier, puis demander un devis ou passer commande à partir de votre panier. C'est une méthode plus rapide, plus économique, et vous pourrez bénéficier des remises disponibles ainsi que d'autres avantages