![discount label](https://static.cymitquimica.com/public/img/discount.png)
Amyloid β-Protein (1-39) trifluoroacetate salt
CAS : 115427-62-8
Ref. 3D-FA110113
1mg | 483,00 € | ||
2mg | 741,00 € | ||
5mg | 1.393,00 € | ||
250µg | 191,00 € | ||
500µg | 300,00 € |
Informations sur le produit
- H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe- Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-G ly-Leu-Met-Val-Gly-Gly-Val-OH H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGV-OH
Please enquire for more information about Amyloid beta-Protein (1-39) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Propriétés chimiques
Question d’ordre technique sur : 3D-FA110113 Amyloid β-Protein (1-39) trifluoroacetate salt
Si vous souhaitez demander un devis ou passer commande, veuillez plutôt ajouter les produits souhaités à votre panier, puis demander un devis ou passer commande à partir de votre panier. C'est une méthode plus rapide, plus économique, et vous pourrez bénéficier des remises disponibles ainsi que d'autres avantages