Big Endothelin-3 (1-41) amide (human) trifluoroacetate salt
CAS : 133551-97-0
Ref. 3D-FB110162
10mg | 1.739,00 € | ||
25mg | 2.319,00 € | ||
50mg | 2.898,00 € | ||
100mg | 4.057,00 € | ||
250mg | 5.797,00 € |
Informations sur le produit
- H-CTCFTYKDKECVYYCHLDIIWINTPEQTVPYGLSNYRGSFR-NH2
Big endothelin-3 is a peptide that is a potent inhibitor of the endothelin receptor. It has been shown to inhibit the binding of endothelin to its receptors and antagonize the effects of endothelin on cells. Big endothelin-3 is a research tool for studying protein interactions, activators, and ligands. This product is the ammonium acetate salt form.
Propriétés chimiques
Question d’ordre technique sur : 3D-FB110162 Big Endothelin-3 (1-41) amide (human) trifluoroacetate salt
Si vous souhaitez demander un devis ou passer commande, veuillez plutôt ajouter les produits souhaités à votre panier, puis demander un devis ou passer commande à partir de votre panier. C'est une méthode plus rapide, plus économique, et vous pourrez bénéficier des remises disponibles ainsi que d'autres avantages