5-Bromopicolinamide
CAS : 90145-48-5
Ref. 3D-FB153951
| 1g | À demander | |
| 2g | À demander | |
| 5g | À demander | |
| 10g | À demander | |
| 500mg | À demander |
Informations sur le produit
- 2-Pyridinecarboxamide, 5-Bromo-
5-Bromopicolinamide is a matrix-assisted laser desorption/ionization (MALDI) proteolytic peptide. It has been shown to be effective at cleaving myoglobin, which is an important part of the muscle protein that stores oxygen for use during exercise. 5-Bromopicolinamide is also able to detect the presence of phosphorylation sites on proteins. This compound is used as a substrate in MALDI mass spectrometry and has been successfully applied to the identification of phosphorylation sites on myoglobin and other proteins. The amino acid sequence of this compound has also been determined and annotated in databases such as UniProtKB/Swiss-Prot and NCBI Protein database.br>br>
br>
Sequences:
br>br>
METDVVELLHLEQLAQERELKLNVEGAEAVAKRRKDGLATTVSPSNTPGGGGRL
Propriétés chimiques
Question d’ordre technique sur : 3D-FB153951 5-Bromopicolinamide
Si vous souhaitez demander un devis ou passer commande, veuillez plutôt ajouter les produits souhaités à votre panier, puis demander un devis ou passer commande à partir de votre panier. C'est une méthode plus rapide, plus économique, et vous pourrez bénéficier des remises disponibles ainsi que d'autres avantages
