Gastric Inhibitory Polypeptide (1-30) amide (porcine)
CAS : 134846-93-8
Ref. 3D-FG109097
1mg | 922,00 € | ||
2mg | 1.478,00 € | ||
5mg | 3.213,00 € | ||
250µg | 359,00 € | ||
500µg | 556,00 € |
Informations sur le produit
- H-Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-Arg-Gln- Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-NH2 H-YA EGTFISDYSIAMDKIRQQDFVNWLLAQK-NH2
Please enquire for more information about Gastric Inhibitory Polypeptide (1-30) amide (porcine) including the price, delivery time and more detailed product information at the technical inquiry form on this page
Propriétés chimiques
Question d’ordre technique sur : 3D-FG109097 Gastric Inhibitory Polypeptide (1-30) amide (porcine)
Si vous souhaitez demander un devis ou passer commande, veuillez plutôt ajouter les produits souhaités à votre panier, puis demander un devis ou passer commande à partir de votre panier. C'est une méthode plus rapide, plus économique, et vous pourrez bénéficier des remises disponibles ainsi que d'autres avantages