
Peptide YY (human) trifluoroacetate salt
CAS : 118997-30-1
Ref. 3D-FP110394
1mg | 797,00 € | ||
2mg | 1.286,00 € | ||
5mg | 2.785,00 € | ||
250µg | 333,00 € | ||
500µg | 478,00 € |
Informations sur le produit
- H-Tyr-Pro-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Ar g-Gln-Arg-Tyr-NH2 H-YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2
- H-Tyr-Pro-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2
Peptide YY (PYY) is a 36-amino acid peptide that is secreted by the gut. PYY is a potent inhibitor of food intake and glucose homeostasis in rats and may be involved in the regulation of lipid metabolism. The trifluoroacetate salt form of PYY has been shown to have improved solubility, stability, and bioavailability. It has also been found to be more selective for the PYY receptor than other forms of PYY. The trifluoroacetate salt form of PYY remains stable to phase chromatography under acidic conditions but degrades at higher pH levels.
Propriétés chimiques
Question d’ordre technique sur : 3D-FP110394 Peptide YY (human) trifluoroacetate salt
Si vous souhaitez demander un devis ou passer commande, veuillez plutôt ajouter les produits souhaités à votre panier, puis demander un devis ou passer commande à partir de votre panier. C'est une méthode plus rapide, plus économique, et vous pourrez bénéficier des remises disponibles ainsi que d'autres avantages