(Ser8)-GLP-1 (7-36) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt
CAS : 215777-46-1
Ref. 3D-FS109310
1mg | 922,00 € | ||
2mg | 1.478,00 € | ||
5mg | 3.213,00 € | ||
250µg | 359,00 € | ||
500µg | 556,00 € |
Informations sur le produit
- H-His-Ser-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2 H-HSE GTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
- 7-36-Glucagon-likepeptide 1 (Octodon degus), 8-L-serine-36-L-argininamide- (9CI)
- L-Argininamide, L-histidyl-L-seryl-L-a-glutamylglycyl-L-threonyl-L-phenylalanyl-L-threonyl-L-seryl-L-a-aspartyl-L-valyl-L-seryl-L-seryl-L-tyrosyl-L-leucyl-L-a-glutamylglycyl-L-glutaminyl-L-alanyl-L-alanyl-L-lysyl-L-a-glutamyl-L-phenylalanyl-L-isoleucyl-L-alanyl-L-tryptophyl-L-leucyl-L-valyl-L-lysylglycyl-
- (Ser79)-Proglucagon (78-107) Amide (Human, Bovine, Guinea Pig, Mouse, Rat) Trifluoroacetate Salt
- 22: PN:WO0155213 SEQID: 22 claimed sequence
Please enquire for more information about (Ser8)-GLP-1 (7-36) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Propriétés chimiques
Question d’ordre technique sur : 3D-FS109310 (Ser8)-GLP-1 (7-36) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt
Si vous souhaitez demander un devis ou passer commande, veuillez plutôt ajouter les produits souhaités à votre panier, puis demander un devis ou passer commande à partir de votre panier. C'est une méthode plus rapide, plus économique, et vous pourrez bénéficier des remises disponibles ainsi que d'autres avantages