5-TAMRA-Amyloid beta-Protein (1-40) trifluoroacetate salt
CAS : 1802087-81-5
Ref. 3D-FT110109
1mg | 3.110,00 € |
Informations sur le produit
- 5-TAMRA-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile- Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH 5TAMRA-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-OH
Please enquire for more information about 5-TAMRA-Amyloid beta-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Propriétés chimiques
Question d’ordre technique sur : 3D-FT110109 5-TAMRA-Amyloid beta-Protein (1-40) trifluoroacetate salt
Si vous souhaitez demander un devis ou passer commande, veuillez plutôt ajouter les produits souhaités à votre panier, puis demander un devis ou passer commande à partir de votre panier. C'est une méthode plus rapide, plus économique, et vous pourrez bénéficier des remises disponibles ainsi que d'autres avantages