Le produit a bien été ajouté au panier.

discount label
Big Endothelin-3 (Human, 1-41 Amide) Acetate
Vue en 3D

Biosynth logo

Big Endothelin-3 (Human, 1-41 Amide) Acetate

CAS : 133551-97-0

Ref. 3D-PED-3739-PI

1mg
2.006,00 €
100µg
503,00 €
Livraison estimée en/au États-Unis, le mardi 4 février 2025

Informations sur le produit

Nom :
Big Endothelin-3 (Human, 1-41 Amide) Acetate
Synonymes :
  • H-CTCFTYKDKECVYYCHLDIIWINTPEQTVPYGLSNYRGSFR-NH2
Description :

Big Endothelin-3 (Human, 1-41 Amide) is a precursor molecule of the Endothelin-3 (ET-3) peptide, that belongs to the large family of endothelin peptides which activate the G-protein coupled receptors ETA and ETB. However ET-3 has lower affinity for the ETA receptors compared to Endothelin-1 (ET-1) and Endothelin-2 (ET-2), whereas all three endothelins have similar affinity for ETB receptors. As ETB receptors make up around 90% of the endothelin receptors found in the cerebral cortex in humans, ET-3 can be nicknamed the ‘brain endothelin’. Also through ET-3’s activation of ETB receptors, ET-3 is involved in the development of the enteric nervous system which controls within the gut, blood flow, secretion and intestinal motility. This product has disulfide bonds between Cys1-Cys15 and Cys3-Cys11.

Avis:
Nos produits sont destinés uniquement à un usage en laboratoire. Pour tout autre usage, veuillez nous contacter.
Marque:
Biosynth
Stockage à long terme :
Notes :

Propriétés chimiques

Masse moléculaire :
4,923.65 g/mol
Formule :
C223H322N56O63S4
Degré de pureté :
Min. 95%
MDL:
Point de fusion :
Point d'ébullition :
Point d'éclair :
Densité :
Concentration :
EINECS :
Merck :
Code SH :

Informations sur les risques

Numéro ONU :
EQ:
Classe :
Phrases R :
Phrases S :
Transport aérien interdit :
Informations sur les risques :
Groupe d'emballage :
LQ :

Question d’ordre technique sur : 3D-PED-3739-PI Big Endothelin-3 (Human, 1-41 Amide) Acetate

Veuillez plutôt utiliser le panier afin de demander un devis ou passer commande

Si vous souhaitez demander un devis ou passer commande, veuillez plutôt ajouter les produits souhaités à votre panier, puis demander un devis ou passer commande à partir de votre panier. C'est une méthode plus rapide, plus économique, et vous pourrez bénéficier des remises disponibles ainsi que d'autres avantages

* Champ obligatoire
Bienvenue chez CymitQuimica !Nous utilisons des cookies pour améliorer votre visite. Nous n’incluons pas de publicité.

Veuillez consulter notre Politique de Cookies pour plus de détails ou ajustez vos préférences dans "Configurer".