Oxyntomodulin, Glucagon-37 (Human, Mouse, Rat)
CAS : 159002-68-3
Ref. 3D-PGL-3826-PI
1mg | 1.007,00 € | ||
5mg | 3.783,00 € |
Informations sur le produit
- Oxm (Human, Mouse, Rat)
- Oxyntomodulin (Human, Mouse, Rat)
- Preproglucagon (53-89) (Human, Mouse, Rat)
- Proglucagon (33-69) (Human, Mouse, Rat)
- H-His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr-Lys-Arg-Asn-Arg-Asn-Asn-Ile-Ala-Oh
Oxyntomodulin, Glucagon-37 (Human, Mouse, Rat) is an inhibitor of gastric acid secretion and pancreatic enzyme secretion and has been shown to reduce food intake and increase energy expenditure in humans. This product is available in the trifluoroacetate salt form.
One letter code: HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA
Propriétés chimiques
Question d’ordre technique sur : 3D-PGL-3826-PI Oxyntomodulin, Glucagon-37 (Human, Mouse, Rat)
Si vous souhaitez demander un devis ou passer commande, veuillez plutôt ajouter les produits souhaités à votre panier, puis demander un devis ou passer commande à partir de votre panier. C'est une méthode plus rapide, plus économique, et vous pourrez bénéficier des remises disponibles ainsi que d'autres avantages