H-VGGASSLENTVDLHISNSHPLSLTSDQYK^-OH
Ref. 3D-PP41603
| Taille indéfinie | À demander |
Informations sur le produit
Peptide H-VGGASSLENTVDLHISNSHPLSLTSDQYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-VGGASSLENTVDLHISNSHPLSLTSDQYK^-OH include the following: Systematic characterization by mass spectrometric analysis of phosphorylation sites in IRF-3 regulatory domain activated by IKK-i K Fujii, S Nakamura, K Takahashi, F Inagaki - Journal of proteomics, 2010 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1874391910000461 Identification of a novel in vivo virus-targeted phosphorylation site in interferon regulatory factor-3 (IRF3) B Bergstroem , IB Johnsen, TT Nguyen, L Hagen - Journal of biological , 2010 - ASBMBhttps://www.jbc.org/article/S0021-9258(20)66357-8/abstract
Propriétés chimiques
Question d’ordre technique sur : 3D-PP41603 H-VGGASSLENTVDLHISNSHPLSLTSDQYK^-OH
Si vous souhaitez demander un devis ou passer commande, veuillez plutôt ajouter les produits souhaités à votre panier, puis demander un devis ou passer commande à partir de votre panier. C'est une méthode plus rapide, plus économique, et vous pourrez bénéficier des remises disponibles ainsi que d'autres avantages
