H-YSSDPTGALTEDSIDDTFLPVPEYINQSVPK^-OH
Ref. 3D-PP47267
Taille indéfinie | À demander |
Informations sur le produit
Peptide H-YSSDPTGALTEDSIDDTFLPVPEYINQSVPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-YSSDPTGALTEDSIDDTFLPVPEYINQSVPK^-OH include the following: EGFR S1166 phosphorylation induced by a combination of EGF and gefitinib has a potentially negative impact on lung cancer cell growth BF Assiddiq, KY Tan, W Toy, SP Chan - Journal of proteome , 2012 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/pr3002029
Propriétés chimiques
Question d’ordre technique sur : 3D-PP47267 H-YSSDPTGALTEDSIDDTFLPVPEYINQSVPK^-OH
Si vous souhaitez demander un devis ou passer commande, veuillez plutôt ajouter les produits souhaités à votre panier, puis demander un devis ou passer commande à partir de votre panier. C'est une méthode plus rapide, plus économique, et vous pourrez bénéficier des remises disponibles ainsi que d'autres avantages