H-IHPFAQTQSLVYPFPGPIPNSLPQNIPPLTQTPVVVPPFLQPEVMGVSK-OH
Ref. 3D-PP48413
| 1mg | 738,00 € | ||
| 10mg | 870,00 € | ||
| 100mg | 1.821,00 € |
Informations sur le produit
Peptide H-IHPFAQTQSLVYPFPGPIPNSLPQNIPPLTQTPVVVPPFLQPEVMGVSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-IHPFAQTQSLVYPFPGPIPNSLPQNIPPLTQTPVVVPPFLQPEVMGVSK-OH include the following: Variation of six bioactive milk proteins from milk from Chinese commercial dairy farms: Effect of season, farm, breed and udder health status S Tang, L Zhang, G Duan, L Wu, J Chen - Journal of Dairy , 2023 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1111/1471-0307.12915
Propriétés chimiques
Question d’ordre technique sur : 3D-PP48413 H-IHPFAQTQSLVYPFPGPIPNSLPQNIPPLTQTPVVVPPFLQPEVMGVSK-OH
Si vous souhaitez demander un devis ou passer commande, veuillez plutôt ajouter les produits souhaités à votre panier, puis demander un devis ou passer commande à partir de votre panier. C'est une méthode plus rapide, plus économique, et vous pourrez bénéficier des remises disponibles ainsi que d'autres avantages
