H-PGQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC-OH
Ref. 3D-PP49553
| 1mg | 601,00 € | ||
| 10mg | 740,00 € | ||
| 100mg | 1.462,00 € |
Informations sur le produit
Peptide H-PGQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-PGQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC-OH include the following: TransCon CNP, a sustained-release C-type natriuretic peptide prodrug, a potentially safe and efficacious new therapeutic modality for the treatment of comorbidities VM Breinholt, CE Rasmussen, PH Mygind - of Pharmacology and , 2019 - ASPEThttps://jpet.aspetjournals.org/content/370/3/459.abstract
Propriétés chimiques
Question d’ordre technique sur : 3D-PP49553 H-PGQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC-OH
Si vous souhaitez demander un devis ou passer commande, veuillez plutôt ajouter les produits souhaités à votre panier, puis demander un devis ou passer commande à partir de votre panier. C'est une méthode plus rapide, plus économique, et vous pourrez bénéficier des remises disponibles ainsi que d'autres avantages
