CymitQuimica logo

Human beta-defensin-2 peptide

Ref. 3D-PP51063

100µg
555,00€
Human beta-defensin-2  peptide
Biosynth

Informations sur le produit

Nom:Human beta-defensin-2 peptide
Synonymes :
  • H-GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP-OH
Marque:Biosynth
Description :Human beta-defensin-2 (hBD-2), also known as skin-antimicrobial peptide 1 (SAP1) is a cysteine-rich cationic antimicrobial peptide of 41 amino acids. It was originally isolated from skin cells of psoriasis patients. hBD-2, which belongs to the defensin family, is implicated in the innate immunity thanks to its antimicrobial activity. Thus, β-defensins can play a role at the cutaneous level by limiting the use of antibiotics in severe burns and disease like psoriasis. Moreover, at the pulmonary level, defensins might be involved in the resorption of the infection in cases of cystic fibrosis.hBD-2 is produced after stimulation of epithelial cells following their contact with some organisms like Gram-negative bacteria and Candida Albicans, fungus or cytokines such as TNF-alpha and IL-1 beta. This antimicrobial activity was shown to be microbicidal at concentrations greater than 1 µM and was lethal for E.Coli and pseudomonas (LD90 : 10 mg/mL) and Candida Albicans (LD90 : 25 mg/mL). Besides its antimicrobial activity, hBD-2 also exhibits proinflammatory properties as chemoattractants for memory T-cells, immature dendritic cells, mast cells and neutrophils.hBD-2 has also demonstrated inhibitory activity of the voltage-gated potassium channel Kv1.3 at picomolar concentration. Kv1.3 are overexpressed by T-cells in case of autoimmune disorders.
Avis:Nos produits sont destinés uniquement à un usage en laboratoire. Pour tout autre usage, veuillez nous contacter.

Propriétés chimiques

Question d’ordre technique à propos de: Human beta-defensin-2 peptide

Veuillez plutôt utiliser le panier afin de demander un devis ou passer commande

Veuillez plutôt utiliser le panier afin de demander un devis ou passer commande. Si vous souhaitez demander un devis ou passer commande, veuillez plutôt ajouter les produits souhaités à votre panier, puis demander un devis ou passer commande à partir de votre panier. C'est une méthode plus rapide, plus économique, et vous pourrez bénéficier des remises disponibles ainsi que d'autres avantages.
◻️
CYMIT QUÍMICA, S.L., en tant que responsable du traitement de vos données personnelles, traitera ces dernières afin de répondre à vos questions ou demandes. Vous pouvez accéder à vos données, les corriger et les supprimer. Vous pouvez exercer vos autres droits en consultant les informations complémentaires et détaillées sur la protection des données dans notre politique de confidentialité du site.
* Champ obligatoire.