
Mouse Beta-Defensin 3 peptide
Ref. 3D-PP51064
100µg
555,00€

Informations sur le produit
Nom:Mouse Beta-Defensin 3 peptide
Synonymes :
- H-KKINNPVSCLRKGGRCWNRCIGNTRQIGSCGVPFLKCCKRK-OH
Marque:Biosynth
Description :mouse Beta-Defensin 3 peptide (mBD3), a homolog of human beta-defensin 2 (hBD2), is a cysteine-rich cationic antimicrobial peptide of 41 amino acids which belongs to the defensins family.Defensin peptides are cationic peptides originally produced in various organs. They are involved in the protection against different kinds of pathogens like bacteria, fungi, and several viruses and play an important role in inflammation and wound repair.mBD3 peptide showed antimicrobial activity against Gram-negative bacteria S.Aureus and S.pyogenes and against Gram-positive bacteria like certain strains of P.Aeruginosa (MIC of 8 µg/mL) and E.coli (MIC of 16 µg/mL). Antimicrobial activity has also been demonstrated against C.Albicans.The in vivo and in vitro efficiency of mBD3 against viruses like influenza was also shown. mBD3 can be interesting for therapeutic use.
Avis:Nos produits sont destinés uniquement à un usage en laboratoire. Pour tout autre usage, veuillez nous contacter.
Propriétés chimiques
Question d’ordre technique à propos de: Mouse Beta-Defensin 3 peptide
Veuillez plutôt utiliser le panier afin de demander un devis ou passer commande
Veuillez plutôt utiliser le panier afin de demander un devis ou passer commande. Si vous souhaitez demander un devis ou passer commande, veuillez plutôt ajouter les produits souhaités à votre panier, puis demander un devis ou passer commande à partir de votre panier. C'est une méthode plus rapide, plus économique, et vous pourrez bénéficier des remises disponibles ainsi que d'autres avantages.