TargetMol se distingue parmi les marques de nos partenaires, qui sont plus de 25
We have reached an agreement with TargetMol: CymitQuimica clients will benefit for a 20% discount on all TargetMol products until the end of the year.On our website you can find the products offered by this partner, which has become one of the world's most recognised compound libraries and small molecule inhibitors supplier. TargetMol offers approximately 120 compound libraries and a wide range of chemical products and kits for life sciences.
Se termine le 31 déc.( plus que 8 jours )
Substance P acetate
Substance P acetate is a peptide mainly secreted by neurons and is involved in many biological processes including nociception and inflammation.Formule :C65H102N18O15SDegré de pureté :98.81%Couleur et forme :SolidMasse moléculaire :1407.68N-Acetylcarnosine
CAS :N-Acetylcarnosine (N-Acetyl-L-carnosine) is thought to be able to combat some of the effects of oxidative stress as it has anti-oxidant properties.Formule :C11H16N4O4Degré de pureté :99.69% - >99.99%Couleur et forme :SolidMasse moléculaire :268.27N-Acetylcarnosine acetate
<p>N-Acetylcarnosine acetate, a dipeptide, yields L-carnosine and treats human cataracts.</p>Formule :C13H20N4O6Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :328.32SPR741 TFA (1179330-52-9 free base)
<p>SPR741 TFA (NAB741 TFA) is a cationic peptide derived from polymyxin B and is a potentiator molecule.</p>Formule :C46H74F3N13O15Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :1106.15SPR741
CAS :SPR741, a cationic peptide from polymyxin B, is being developed to treat serious Gram-negative infections.Formule :C44H73N13O13Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :992.13MOG (35-55) TFA
<p>MOG (35-55) TFA is a minor component of central nervous system myelin with encephalitogenic activity</p>Formule :C120H178F3N35O31SDegré de pureté :98%Couleur et forme :SolidMasse moléculaire :2695.97Myelin Basic Protein (MBP) (68-82), guinea pig
CAS :<p>Myelin Basic Protein (MBP) (68-82) is a fragment of myelin basic protein (MBP) with the sequence Tyr-Gly-Ser-Leu-Pro-Gln-Lys-Ser-Gln-Arg-Ser-Gln-Asp-Glu-Asn.</p>Formule :C71H113N23O28Degré de pureté :>99.99%Couleur et forme :SolidMasse moléculaire :1736.79TAK-448 acetate
CAS :TAK-448 acetate (MVT-602 acetate) is a KISS1R agonist, a synthetic peptide similar to kisspeptin.Formule :C60H84N16O16Degré de pureté :99.88%Couleur et forme :SolidMasse moléculaire :1285.41Melanotan I
CAS :Melanotan I is a non-specific melanocortin receptor (MCR) agonist, an α-melanocyte-stimulating hormone (α-MSH) analog, which is injected subcutaneously toFormule :C78H111N21O19Degré de pureté :>99.99%Couleur et forme :SolidMasse moléculaire :1646.85Motilin, canine
CAS :<p>Motilin canine, a 22-amino acid peptide, functions as a robust gastrointestinal smooth muscle contraction agonist.</p>Formule :C120H194N36O34Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :2685.05M-2420
CAS :<p>M-2420 is a fluorogenic substrate designed specifically for the β-secretase site found in the Swedish mutation of the amyloid precursor protein (APP).</p>Formule :C70H91N15O27Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :1574.56[bAla8]-Neurokinin A(4-10)
CAS :[bAla8]-Neurokinin A(4-10) is a neurokinin 2 (NK2) receptor agonist.Formule :C35H56N8O10SDegré de pureté :98%Couleur et forme :SolidMasse moléculaire :780.94Nonapeptide-1 acetate salt (158563-45-2 free base)
<p>Nonapeptide-1 acetate salt (158563-45-2 free base) (Melanostatine-5 acetate salt) , a peptide hormone, is a potent α-Melanocyte-stimulating hormone (α-MSH)</p>Formule :C63H91N15O11SDegré de pureté :98.26%Couleur et forme :SolidMasse moléculaire :1266.58MCH (salmon) TFA (87218-84-6 free base)
MCH, a 19 amino acid peptide in the hypothalamus, regulates arousal, behavior, and food intake in mammals.Formule :C91H140F3N27O26S4Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :2213.5Cotadutide acetate
Cotadutide acetate is a potent GLP-1 and glucagon receptor dual agonist with EC50s of 6.9 pM and 10.2 pM.Formule :C169H256N42O57Degré de pureté :98.28%Couleur et forme :SolidMasse moléculaire :3788.14Melanin Concentrating Hormone, salmon
CAS :Melanin Concentrating Hormone (MCH), a 19 amino acid cyclic peptide, is largely expressed in the hypothalamus.Formule :C89H139N27O24S4Degré de pureté :98%Couleur et forme :White PowderMasse moléculaire :2099.48Melanin Concentrating Hormone, salmon acetate
Melanin Concentrating Hormone, salmon acetate (MCH (salmon)) is a 19 amino acid cyclic peptide, is largely expressed in the hypothalamus.Formule :C91H143N27O26S4Degré de pureté :99.41%Couleur et forme :SolidMasse moléculaire :2157α-Factor Mating Pheromone, yeast (TFA)
The alpha factor pheromone arrests yeast in the G1 phase of their cell cycle.Formule :C84H115N20F3O19SDegré de pureté :98%Couleur et forme :SolidMasse moléculaire :1798.02α-Factor Mating Pheromone, yeast
CAS :<p>Alpha factor mating pheromone is a peptide of 13 amino acids secreted by Saccharomyces cerevisiae α cells.</p>Formule :C82H114N20O17SDegré de pureté :98%Couleur et forme :White PowderMasse moléculaire :1684α-Factor Mating Pheromone, yeast acetate
<p>α-Factor Mating Pheromone, yeast acetate (Mating Factor α acetate) is a peptide of 13 amino acids secreted by Saccharomyces cerevisiae α cells.</p>Formule :C84H118N20O19SDegré de pureté :96.85%Couleur et forme :SolidMasse moléculaire :1744.05Mas7
CAS :<p>Amphiphilic peptide Mas7, a structural analogue of mastoparan is a known activator of heterotrimeric Gi-proteins and its downstream effectors.</p>Formule :C67H124N18O15Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :1421.81Mas7 acetate(145854-59-7 free base)
<p>Mas7 acetate(145854-59-7 free base) (Mastoparan 7 acetate) , a structural analogue of mastoparan is a known activator of heterotrimeric Gi-proteins and its</p>Formule :C69H128N18O17Degré de pureté :99.77%Couleur et forme :SolidMasse moléculaire :1481.86Allergen Gal d 4 (46-61), chicken
CAS :Allergen Gal d 4 (46-61), chicken is a hen egg white lysozyme peptide.Formule :C72H116N22O29Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :1753.82Tirzepatide hydrochloride
Tirzepatide HCl is a dual GIP and GLP-1 receptor agonist.Formule :C225H349N48O68ClDegré de pureté :98%Couleur et forme :SolidMasse moléculaire :4849.91Tirzepatide
CAS :Tirzepatide (LY-3298176) is a dual glucose-dependent polypeptide (GIP) (EC50=0.042 nM) and glucagon-like peptide-1 (GLP-1) (EC50=0.086 nM) receptor agonist.Formule :C225H348N48O68Degré de pureté :99.52% - 99.99%Couleur et forme :SolidMasse moléculaire :4813.45Tirzepatide Acetate(2023788-19-2 free base)
Tirzepatide (LY3298176) Acetate (2023788-19-2 free base) is a new molecule that can control blood glucose levels.Cost-effective and quality-assured.Formule :C227H352N48O70Degré de pureté :97.3% - 98.05%Couleur et forme :SolidMasse moléculaire :4873.5Tirzepatide monosodium salt
Tirzepatide sodium salt (LY3298176 sodium salt) is a GIP and GLP-1 receptor agonist with neuroprotective activity and can be used to treat obesity.Formule :C225H347N48O68NaDegré de pureté :99.69%Couleur et forme :SoildMasse moléculaire :4835.51Luteinizing Hormone Releasing Hormone (LH-RH), salmon
CAS :LH-RH: a hypothalamus-made pituitary hormone, key in reproductive control.Formule :C60H73N15O13Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :1212.31LH-RH, salmon acetate(86073-88-3 free base)
<p>LH-RH salmon acetate (86073-88-3) is a hypothalamic hormone controlling reproduction.</p>Formule :C62H77N15O15Degré de pureté :99.83%Couleur et forme :SolidMasse moléculaire :1272.35[Leu5]-Enkephalin, amide acetate
<p>[Leu5]-Enkephalin, amide acetate is a δ opioid receptor agonist.</p>Formule :C30H42N6O8Degré de pureté :99.36%Couleur et forme :SolidMasse moléculaire :614.69Leucokinin VIII
Leucokinin VIII is an diuretic octapeptide isolated form head extracts of the cockroach.Formule :C42H52N10O11Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :872.92Leucokinin VIII acetate
<p>Leucokinin VIII acetate (Leucokinin 8) is an diuretic octapeptide isolated form head extracts of the cockroach.</p>Formule :C44H56N10O13Degré de pureté :98.52%Couleur et forme :SolidMasse moléculaire :932.99L-Asparaginase
CAS :<p>L-Asparaginase, an enzyme for acute lymphoblastic leukemia treatment, is administered via injection.</p>Formule :NADegré de pureté :97%Couleur et forme :SolidMasse moléculaire :N/AKinetensin
CAS :Kinetensin is a neurotensin-like peptide.Formule :C56H85N17O11Degré de pureté :98%Couleur et forme :White Lyophilised SolidMasse moléculaire :1172.38Kinetensin acetate(103131-69-7 free base)
<p>Kinetensin acetate(103131-69-7 free base) is isolated from pepsin-treated human plasma. Kinetensin acetate(103131-69-7 free base) is a neurotensin-like peptide.</p>Formule :C58H89N17O13Degré de pureté :>99.99%Couleur et forme :SolidMasse moléculaire :1232.45IFN-α Receptor Recognition Peptide 1
CAS :<p>IFN-α Receptor Recognition Peptide 1, associated with receptor interactions, is a peptide of IFN-α.</p>Formule :C35H59N13O12SDegré de pureté :98%Couleur et forme :SolidMasse moléculaire :885.99IRBP(668-687) (TFA) (1977546-93-2 free base)
<p>IRBP(668-687) TFA, a segment of human IRBP, can cause uveitis.</p>Formule :C93H152F3N25O34Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :2221.34Interphotoreceptor retinoid-binding protein(668-687)
CAS :Interphotoreceptor retinoid-binding protein(668-687)is an amino acid residue of human retinoid-binding protein(IRBP) 668-687, which can induce uveitis.Formule :C91H151N25O32Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :2107.32Interphotoreceptor Retinoid Binding Protein Fragment (IRBP)
CAS :<p>IRBP Fragment is a 20-residue peptide in IRBP 161-180, causing post-uveitis (EAU).</p>Formule :C103H157N25O29Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :2209.5IRBP acetate(211426-18-5 free base)
<p>IRBP acetate is a 20-residue peptide epitope in IRBP 161-180, potentially causing uveitis.</p>Formule :C105H161N25O31Degré de pureté :95.54%Couleur et forme :SolidMasse moléculaire :2269.55IGF-I (30-41) TFA(82177-09-1,FREE)
<p>IGF-I (30-41) (TFA) is amino acids 30 to 41 fragment of Insulin-like Growth Factor I (IGF-I).</p>Formule :C51H83N19O19·C2HF3O2Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :1380.36IGF-I (30-41)
CAS :IGF-I (30-41) is amino acids 30 to 41 fragment of Insulin-like Growth Factor I (IGF-I).Formule :C51H83N19O19Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :1266.34IGF-I 30-41 acetate(82177-09-1 free base)
<p>IGF-I 30-41 acetate(82177-09-1 free base) (Insulin-like Growth Factor I (30-41) acetate) is amino acids 30 to 41 fragment of Insulin-like Growth Factor I (IGF-I</p>Formule :C53H87N19O21Degré de pureté :99.21%Couleur et forme :SolidMasse moléculaire :1326.39IGF-I (24-41) TFA (135861-49-3 free base)
IGF-I (24-41) (TFA) is a fragment of IGF-I with anabolic, antioxidant, anti-inflammatory, and cytoprotective properties.Formule :C88H133N27O28·C2HF3O2Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :2131.18IGF-I (24-41)
CAS :<p>IGF-I (24-41) is a fragment of IGF-I, affecting GH activities with anabolic, antioxidant, anti-inflammatory, and cytoprotective properties.</p>Formule :C88H133N27O28Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :2017.16Insulin(cattle)
CAS :<p>Insulin(cattle) is a peptide hormone that promotes glycogen synthesis. Insulin) has hypoglycemic activity. Cost-effective and quality-assured.</p>Formule :C254H377N65O75S6Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :5733.49InsB 9-23
<p>InsB (9-23) is an insulin B-chain peptide that binds to a class II histocompatibility complex (MHC) allele called I-Ag7.</p>Formule :C72H116N20O22S1Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :1645.9Nemifitide diTFA
CAS :<p>Nemifitide diTFA is a synthetic pentapeptide with antidepressant properties, resembling MIF, that crosses the blood-brain barrier.</p>Formule :C37H45F7N10O10Degré de pureté :99.78% - 99.84%Couleur et forme :SolidMasse moléculaire :922.8Nemifitide acetate(173240-15-8 free base)
<p>Nemifitide acetate, synthetic 5-amino acid antidepressant, has quick effect, mimics MIF.</p>Formule :C35H47FN10O8Degré de pureté :97.97%Couleur et forme :SolidMasse moléculaire :754.85Ac-IEPD-AFC
CAS :Ac-IEPD-AFC (IEPD) is a fluorescent substrate for granzyme B and can be used to measure granzyme B activity.Formule :C32H38F3N5O11Degré de pureté :99.16%Couleur et forme :SolidMasse moléculaire :725.67Boc-Ile-Glu-Gly-Arg-AMC
CAS :<p>Boc-IEGR-AMC: fluorogenic substrate for factor Xa and Halocynthia roretzi acrosin.</p>Formule :C34H50N8O10Degré de pureté :98%Couleur et forme :White PowderMasse moléculaire :730.81β-CGRP, human
CAS :<p>β-CGRP, human ,a 37-amino acid peptide,is the beta form of Calcitonin-gene-related peptide (β-CGRP), involved extensively in regulation of the cardiovascular</p>Formule :C162H267N51O48S3Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :3793.41β-CGRP, human TFA (101462-82-2 free base)
<p>β-CGRP,human tissue is one of the calcitonin peptide, through complex behavior of calcitonin receptor like receptor (CRLR) - and receptor activity - modifying</p>Formule :C164H268F3N51O50S3Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :3907.38β-Casomorphin, human TFA (102029-74-3 free base)
<p>β-Casomorphin, human TFA (Human β-casomorphin 7 TFA) an opioid peptide that ACTS as an opioid receptor agonist.</p>Formule :C46H62F3N7O13Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :978.02HCGRP-(8-37)
CAS :Rat CGRP-(8-37) (VTHRLAGLLSRSGGVVKDNFVPTNVGSEAF) is a highly selective CGRP receptor antagonistFormule :C139H230N44O38Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :3125.59HCGRP-(8-37) acetate
<p>HCGRP-(8-37) acetate is a human calcitonin gene-related peptide (hCGRP) fragment acetate and also an antagonist of CGRP receptor.</p>Formule :C141H234N44O40Degré de pureté :99.29%Couleur et forme :SolidMasse moléculaire :3185.64Secretin (28-54), human TFA
<p>Secretin (28-54), human TFA is a 27-amino acid peptide that works on the human Secretin receptor.</p>Formule :C132H221N44F3O42Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :3153.48Secretin (28-54), human
CAS :Secretin (28-54), human, is a 27-amino acid residue peptide with a C-terminal amidation, acting on human secretin receptors.Formule :C130H220N44O40Degré de pureté :98%Couleur et forme :PowderMasse moléculaire :3039.46Pancreatic Polypeptide, human
CAS :<p>Endogenous high affinity agonist for human NPY Y4 receptor (Ki = 0.056 nM). Believed to play an important role in the function of the gastrointestinal tract.</p>Formule :C185H287N53O54S2Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :4181.71Pancreatic Polypeptide (human) acetate
Pancreatic Polypeptide (human) acetate is a C-terminally amidated 36 amino acid peptide, which acts as a neuropeptide Y (NPY) Y4/Y5 receptor agonist.Degré de pureté :97.26%Couleur et forme :LiquidMasse moléculaire :N/AOrexin B, human TFA (205640-91-1 free base)
<p>Orexin B, human (TFA) is an endogenous agonist at Orexin receptor with Kis of 420 and 36 nM for OX1 and OX2.</p>Formule :C123H212N44O35S·C2HF3O2Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :3013.36Orexin B, human
CAS :Orexin B, human agonizes Orexin receptors (OX1 Ki=420 nM, OX2 Ki=36 nM), promotes feeding in rats, and is a neuropeptide.Formule :C123H212N44O35SDegré de pureté :98%Couleur et forme :SolidMasse moléculaire :2899.34Neuropeptide Y (human)
CAS :<p>Neuropeptide Y (29-64), amide, human is a biologically active 36-amino acid peptide.</p>Formule :C189H285N55O57SDegré de pureté :98%Couleur et forme :SolidMasse moléculaire :4271.68Neuropeptide Y (29-64), amide, human acetate
Neuropeptide Y (29-64), amide, human acetate is involved in Alzheimer's disease (AD) and protects rat cortical neurons against β-Amyloid toxicity.Degré de pureté :98.42%Couleur et forme :LiquidMasse moléculaire :N/AGLP-1(7-36), amide acetate
CAS :GLP-1(7-36), amide acetate is a derivative of GLP-1 peptide , activate the GLP-1 receptor, promote insulin secretion,Type 2 diabetes mellitus and obesity.Formule :C151H230N40O47Degré de pureté :99.89%Couleur et forme :SolidMasse moléculaire :3357.68Fibrinopeptide A, human TFA
CAS :Human fibrinopeptide A, a 16-residue peptide, is thrombin-cleaved from fibrinogen's Aα chain NH2-terminus, aiding fibrin polymerization.Formule :C67H99F6N19O30Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :1764.6Fibrinopeptide A, human
CAS :Human Fibrinopeptide A: 16-residue peptide from fibrinogen's Aα region, cleaved by thrombin.Formule :C63H97N19O26Degré de pureté :98%Couleur et forme :White Lyophilized PowderMasse moléculaire :1536.56Fibrinopeptide A, human acetate
Human Fibrinopeptide A acetate is a 16-amino acid peptide from fibrinogen's N-terminal Aα, cleaved by thrombin.Formule :C65H101N19O28Degré de pureté :>99.99%Couleur et forme :SolidMasse moléculaire :1596.65Corticotropin-releasing factor (human)
CAS :Human CRF is a neuropeptide that releases ACTH, stimulates the nervous system, and antagonizes inflammation.Formule :C208H344N60O63S2Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :4757.45Corticotropin-releasing factor (human) acetate
Corticotropin-releasing factor (human) acetate stimulates to synthesize and secret adrenocorticotropin in the anterior pituitary.Degré de pureté :98.30%Couleur et forme :LiquidAdrenomedullin (AM) (1-52), human TFA
Adrenomedullin (AM) (1-52), human (TFA) is an NH2 terminal truncated adrenomedullin analogue,affects cell proliferation and angiogenesis in cancer.Formule :C266H407F3N80O79S3Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :6142.76Adrenomedullin (AM) (1-52), human
CAS :Adrenomedullin (AM) (1-52), human is a 52-amino acid peptide that modulates cellular proliferation and angiogenesis in cancer.Formule :C264H406N80O77S3Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :6028.82Glucagon-like peptide 1 (1-37), human TFA
Human Glucagon-like peptide 1 (1-37) TFA is a potent GLP-1 receptor agonist derived from proglucagon.Formule :C188H276N51F3O61Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :4283.5Glucagon-like peptide 1 (1-37), human
CAS :<p>Human GLP-1 (1-37) is a potent GLP-1 receptor agonist without impact on rat food intake or insulin secretion.</p>Formule :C186H275N51O59Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :4169.48Glucagon-like peptide 1 (1-37), human acetate
Glucagon-like peptide 1 (1-37), human acetate is a highly potent the GLP-1 receptor agonist.Degré de pureté :98%Couleur et forme :LiquidMasse moléculaire :N/AHIV-1 Rev (34-50)
CAS :HIV-1 Rev (34-50) (HIV-1 rev Protein (34-50)) is a 17 amino acid peptide with anti-HIV-1 activity.Formule :C97H173N51O24Degré de pureté :99.91%Couleur et forme :SolidMasse moléculaire :2437.74Gly6
CAS :Gly6 is a linear peptide with six amino acids.Formule :C12H20N6O7Degré de pureté :98%Couleur et forme :White To Off- White PowderMasse moléculaire :360.32Fibronectin Adhesion-promoting Peptide TFA
Fibronectin peptide aids MSC aggregation by heparin-binding, promoting spheroid assembly.Formule :C49H75F3N16O12Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :1137.22Fibronectin Adhesion-promoting Peptide
CAS :Heparin-binding peptide aids adhesion, part of fibronectin's carboxy-terminal domain.Formule :C47H74N16O10Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :1023.19Fibronectin Adhesion-promoting Peptide acetate
<p>Fibronectin Adhesion-promoting Peptide acetate is a heparin-binding sequence from fibronectin's carboxy-terminal.</p>Formule :C49H78N16O12Degré de pureté :>99.99%Couleur et forme :SolidMasse moléculaire :1083.25Exendin-4 peptide derivative acetate
Exendin-4 peptide derivative acetate is an acetate salt of Exendin-4 peptide derivative.Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :N/AHuman growth hormone-releasing factor
CAS :<p>GHRH from the hypothalamus prompts the pituitary to produce/release GH by attaching to the GHRHR.</p>Formule :C215H358N72O66SDegré de pureté :98%Couleur et forme :SolidMasse moléculaire :5039.65Human growth hormone-releasing factor acetate
Human growth hormone-releasing factor acetate is a hypothalamic polypeptide and stimulates GH production and release by binding to the GHRH Receptor (GHRHR) onDegré de pureté :99.26%Couleur et forme :LiquidMasse moléculaire :N/AH-Gly-Gly-Pro-OH
CAS :H-Gly-Gly-Pro-OH (Glycyl-glycyl-L-proline) is a dipeptide composed of glycine and proline, and is an end product of collagen metabolism.Formule :C9H15N3O4Degré de pureté :97.44%Couleur et forme :SolidMasse moléculaire :229.23GLP-2(1-33)(human)
CAS :GLP-2(1-33) (human) is an enteroendocrine hormone which stimulates the growth of the intestinal epithelium.Formule :C165H254N44O55SDegré de pureté :98%Couleur et forme :SolidMasse moléculaire :3766.19Copper tripeptide
CAS :GHK-Cu is a copper complex with the peptide glycyl-L-histidyl-L-lysine, found in human plasma, saliva, and urine.Formule :C14H22CuN6O4Degré de pureté :99.94% - >99.99%Couleur et forme :SolidMasse moléculaire :401.91Boc-Gly-Gly-Phe-Gly-OH
CAS :Boc-Gly-Gly-Phe-Gly-OH is a self-assembly of N- and C-protected tetrapeptide.Formule :C20H28N4O7Couleur et forme :SolidMasse moléculaire :436.46Boc-Gly-Gly-Phe-Gly-OH acetate
<p>Boc-Gly-Gly-Phe-Gly-OH acetate (GGFG acetate) is a self-assembly of N- and C-protected tetrapeptide.</p>Formule :C22H32N4O9Degré de pureté :99.86%Couleur et forme :SolidMasse moléculaire :496.52Hexa-D-arginine TFA
CAS :<p>Hexa-D-arginine TFA (Furin Inhibitor II TFA) is an inhibitor of furin (Ki values are 0.106, 0.58 and 13.2 μM for furin, PACE4 and PC1 respectively).</p>Formule :C38H76F3N25O8Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :1068.17Exendin-4 peptide derivative
<p>Exendin-4 derivative FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS linked to GLP-1/glucagon agonism.</p>Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :3692.15Fibrinopeptide B, human TFA (36204-23-6 free base)
<p>FibrinopeptideB,human is a 14-amino acid polypeptide released from the amino terminus of the fibrinogen segment.</p>Formule :C68H94F3N19O27Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :1666.58Fibrinopeptide B, human
CAS :Fibrinopeptide B (FPB) is produced during the cleavage of fibrinogen, by thrombin, to fibrin monomer.Formule :C66H93N19O25Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :1552.56N-Formyl-Nle-Leu-Phe-Nle-Tyr-Lys TFA
<p>FPR agonist, chemoattracts neutrophils, retains activity when radioiodinated.</p>Formule :C45H66F3N7O11Degré de pureté :97.1%Couleur et forme :SolidMasse moléculaire :938.04ZINC77292789
CAS :ZINC77292789 (Fmoc-Thr[GalNAc(Ac)3-α-D]-OH) is a reagent for the preparation of a synthetic MUC1 Glycopeptide Bearing βGalNAc-Thr as a Tn antigen isomer whichFormule :C33H38N2O13Degré de pureté :99.24%Couleur et forme :SolidMasse moléculaire :670.66Fmoc-Arg-OH
CAS :Fmoc-Arg-OH (Fmoc-L-Arginine) (Fmoc-L-Arginine) is a used in peptide synthesis.Formule :C21H24N4O4Degré de pureté :>99.99%Couleur et forme :White SolidMasse moléculaire :396.44N-Formyl-Met-Leu-Phe-Lys
CAS :<p>fMLFK: potent FPR1 agonist; EC50=3.5 nM (FPR1), 6.7 μM (FPR2), 0.88 μM (FPR2-D2817.32G); binds leukocytes; aids neutrophil assessment.</p>Formule :C27H43N5O6SDegré de pureté :99.7%Couleur et forme :SolidMasse moléculaire :565.73Flagelin 22 TFA (304642-91-9 free base)
<p>Flagelin 22 TFA (Flagellin 22 TFA), a fragment of bacterial flagellin, is an effective elicitor in both plants and algae.</p>Formule :C95H163F3O36N32Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :2386.53Flagelin 22
CAS :Flagelin 22, a bacterial flagellin fragment, serves as a potent elicitor for plants and algae.Formule :C93H162N32O34Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :2272.48Flagelin 22 acetate
Flagelin 22 acetate is part of the bacterial flagellin family and is an effective inducer in plants and algae.Formule :C95H166N32O36Degré de pureté :95.93%Couleur et forme :SolidMasse moléculaire :2332.56Apraglutide TFA (1295353-98-8 free base)
Apraglutide TFA is a synthetic 33-amino acid, long-acting GLP-2 analog that promotes intestine growth in short bowel syndrome.Formule :C172H263N43O52·C2HF3O2Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :3879.27Apraglutide
CAS :Apraglutide (FE 203799 is a synthetic 33-amino acid peptide and long-acting glp-2 analogue.Formule :C172H263N43O52Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :3765.25Endothelin-3 (Rat,Human) (TFA)
<p>Endothelin-3 (Rat, Human) (TFA) is a 21-amino acid vasoactive peptide of endothelial origi, an agonist for the endothelin receptor type B (EDNRB).</p>Formule :C123H169F3N26O35S4·xC2HF3O2Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :2757.07 (free base)Endothelin-2 (49-69), human
CAS :Endothelin-2 (49-69), human (Human endothelin-2) is a 21-amino acid vasoactive peptide that binds to G-protein-linked transmembrane receptors, ET-RA and ET-RB.Formule :C115H160N26O32S4Degré de pureté :98.26%Couleur et forme :SolidMasse moléculaire :2546.92Endothelin-3, human, mouse, rabbit, rat
CAS :<p>Endothelin-3, human, mouse, rabbit, rat , is a cyclic 21 amino acid peptide. It is an endogenous neuropeptide and potent vasoconstrictor.</p>Formule :C121H168N26O33S4Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :2643.04Eledoisin
CAS :<p>Eledoisin (Eledone peptide) is a specific agonist of NK2 and NK3 receptors.Eledoisin is an undecapeptide of mollusk origin, belonging to the tachykinin family</p>Formule :C54H85N13O15SDegré de pureté :98%Couleur et forme :SolidMasse moléculaire :1188.4Porcine dynorphin A(1-13)
CAS :Porcine dynorphin A (1-13) is a potent κ opioid receptor agonist; it's antinociceptive and raises [Ca2+]i in neurons like NMDA.Formule :C75H126N24O15Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :1603.95Porcine dynorphin A(1-13) acetate
<p>Porcine dynorphin A(1-13) acetate is a potent κ-opioid agonist with antinociceptive properties, increasing [Ca2+]i like NMDA.</p>Formule :C77H130N24O17Degré de pureté :99.14%Couleur et forme :SolidMasse moléculaire :1664Dolastatin 10
CAS :Dolastatin 10 (DLS 10) is a powerful peptide with antimitotic properties, effectively inhibiting tubulin polymerization.Formule :C42H68N6O6SDegré de pureté :99.00%Couleur et forme :SolidMasse moléculaire :785.09Bradykinin (2-9)
CAS :Bradykinin (2-9) (Des-Arg1-bradykinin) is an amino-truncated peptide compound that is a metabolite of Bradykinin.Formule :C44H61N11O10Degré de pureté :>99.99%Couleur et forme :SolidMasse moléculaire :904.02Amylin, amide, human
CAS :Amylin, amide, human(DAP Amide) is a 37-amino acid peptide hormone co-secreted with insulin to regulate postprandial glucose levels.Formule :C165H261N51O55S2Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :3903.28Cys-TAT(47-57)
CAS :Cys-TAT(47-57): arginine-rich peptide from HIV-1 TAT protein's transduction domain.Formule :C67H124N34O14SDegré de pureté :98%Couleur et forme :SolidMasse moléculaire :1661.99Cys-TAT(47-57) acetate(583836-55-9 Free base)
Cys-TAT(47-57) acetate is derived from the HIV-1 transactivating protein. Cys-TAT(47-57) acetate is an arginine rich peptide that can penetrate cells.Formule :C69H128N34O16SDegré de pureté :95.1100%Couleur et forme :SolidMasse moléculaire :1722.04Cyclo(Phe-Pro)
CAS :Cyclo(Phe-Pro) (A-64863) known as a secondary metabolite of some bacteria and fungi, is also produced by Vibrio vulnificus.Formule :C14H16N2O2Degré de pureté :98.27%Couleur et forme :SolidMasse moléculaire :244.29Cyclo(Phe-Pro) acetate(14705-60-3 free base)
Cyclo(Phe-Pro) acetate(14705-60-3 free base), known as a secondary metabolite of some bacteria and fungi, is also produced by Vibrio vulnificus.Formule :C16H20N2O4Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :304.35C-Type Natriuretic Peptide (CNP) (1-22), human
CAS :C-Type Natriuretic Peptide (CNP) (1-22), human is the 1-22 fragment of C-Type Natriuretic Peptide.Formule :C93H157N27O28S3Degré de pureté :>99.99%Couleur et forme :SolidMasse moléculaire :2197.6Cortistatin 14, human, rat
CAS :<p>Cortistatin 14: a neuropeptide similar to somatostatin; induces sleep, depresses neuronal activity; found in cortex, hippocampus.</p>Formule :C81H113N19O19S2Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :1721.01Cortistatin 14, human, rat acetate
Cortistatin 14, human, rat acetate is a neuropeptide having structural similarity to somatostatin-14 and shows anticonvulsive, neuroprotective effects andFormule :C80H112N18O19S2Degré de pureté :97.86%Couleur et forme :SolidMasse moléculaire :1693.98C-Peptide, dog
CAS :Dog C-Peptide, part of proinsulin, is secreted by pancreatic beta cells with insulin; vital for insulin biosynthesis, once deemed inert.Formule :C137H225N37O49Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :3174.47CRF, bovine TFA (92307-52-3 free base)
<p>CRF, bovine (TFA), agonizes CRF receptor, displacing [125I-Tyr]ovine CRF, Ki 3.52 nM, pEC50s: hCRF1 11.16, hCRF2 8.53, rCRF2α 8.70.</p>Formule :C208H341F3N60O65SDegré de pureté :98%Couleur et forme :SolidMasse moléculaire :4811.36CRF, bovine
CAS :CRF, bovine is a potent agonist of CRF receptor, and displaces [125I-Tyr]ovine CRF with a Ki of 3.52 nM.Formule :C206H340N60O63SDegré de pureté :98%Couleur et forme :SolidMasse moléculaire :4697.34Conopressin S
CAS :Conopressin S, isolated from Conus striatus, shows high affinity with vasopressin V1b receptor (AVPR1B), with a Ki of 8.3 nM.Formule :C41H73N17O10S2Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :1028.26Conopressin S acetate(111317-90-9 free base)
<p>Conopressin S acetate(111317-90-9 free base) (Con-S acetate) is a natural product isolated from Conus striatus, shows high affinity with vasopressin V1b</p>Formule :C43H77N17O12S2Degré de pureté :99.79%Couleur et forme :SolidMasse moléculaire :1088.32C3a (70-77) TFA (63555-63-5 free base)
C3a (70-77) TFA (Complement 3a (70-77) TFA) is a COOH-terminal fragment of the C3a anaphylatoxin peptide.Formule :C37H62F3N13O12Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :937.96Cibinetide
CAS :<p>Cibinetide (ARA290) is a nonerythropoietic peptide engineered from erythropoietin,, and used for neurological disease treatment.</p>Formule :C51H84N16O21Degré de pureté :≥95%Couleur et forme :SolidMasse moléculaire :1257.31D-Lys(Z)-Pro-Arg-pNA
CAS :D-Lys(Z)-Pro-Arg-pNA is a luminescent substrate of activated protein C (APC).Formule :C31H43N9O7Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :653.73Sincalide
CAS :Sincalide (CCK-8) is an injectable drug used to diagnose gallbladder and pancreas disorders; it's a cholecystokinin fragment.Formule :C49H62N10O16S3Degré de pureté :98.32%Couleur et forme :SolidMasse moléculaire :1143.27Sincalide ammonium
CAS :<p>Sincalide ammonium, a CCK analog, stimulates bile release, gallbladder contraction, and sphincter relaxation, aiding in diagnoses.</p>Formule :C49H65N11O16S3Degré de pureté :98.46%Couleur et forme :SolidMasse moléculaire :1160.3Urotensin I
CAS :Urotensin I, 41-aa neuropeptide, agonist for human/rat CRF receptors, lowers blood pressure in rats, isolated from white suckers.Formule :C210H340N62O67S2Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :4869.46Urotensin I acetate (83930-33-0 Free base)
Urotensin I acetate, CRF1/CRF2 agonist: pEC50s - hCRF1 11.46, hCRF2 9.36, rCRF2α 9.85; KIs - hCRF1 0.4 nM, rCRF2α 1.8 nM, mCRF2β 5.7 nM.Degré de pureté :95.44% - 99.73%Couleur et forme :SolidMasse moléculaire :N/ACGRP (83-119), rat TFA
CGRP (83-119), rat TFA (Calcitonin Gene Related Peptide(83-119), rat TFA) is a 37 amino acid calcitonin family of neuropeptide, acts through calcitonin receptorFormule :C162H262N50O52S2·C2HF3O2Degré de pureté :>99.99%Couleur et forme :SolidMasse moléculaire :3920.32CGRP II, rat (TFA) (99889-63-1 free base)
Calcitonin Gene Related Peptide (CGRP) II, rat (TFA) is a neuropeptide with 37 amino acid.Formule :C165H268F3N51O52S2Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :3919.33Calcitonin Gene Related Peptide (CGRP) II, rat
CAS :<p>CGRP II is a potent vasodilator that boosts pancreatic enzyme levels by activating β-cell receptors.</p>Formule :C163H267N51O50S2Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :3805.31CGRP(83-119), rat
<p>Calcitonin Gene Related Peptide (CGRP) (83-119), rat is a 37 amino acid calcitonin family of neuropeptide, acts through calcitonin receptor-like receptor.</p>Formule :C162H262N50O52S2Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :3806.3iRGD peptide
CAS :<p>iRGD peptide: 9-amino acid cyclic compound (CRGDKGPDC), found through phage display in mice with tumors.</p>Formule :C35H57N13O14S2Degré de pureté :98.77%Couleur et forme :SolidMasse moléculaire :948.04Velmupressin acetate
CAS :Potent, selective, short-acting peptidic V2R agonist; EC50: 0.07 nM (hV2R), 0.02 nM (rV2R).Formule :C44H64ClN11O10S2Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :1006.63BNP-45 (rat) (TFA) (123337-89-3 free base)
<p>BNP-45 (rat) TFA is a circulating form of rat brain natriuretic peptide isolated from rat heart with potent hypotensive and natriuretic potency.</p>Formule :C215H350N71O67F3S3Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :5154.69Brain Natriuretic Peptide-45, rat
CAS :BNP-45 (rat) is a circulating form of rat brain natriuretic peptide isolated from rat heart with potent hypotensive and natriuretic potency.Formule :C213H349N71O65S3Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :5040.67Nesiritide
CAS :<p>Nesiritide, recombinant human B-type natriuretic peptide, binds NPR-A/C with Kd 7.3/13 pM.</p>Formule :C143H244N50O42S4Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :3464.04BNP (1-32), rat TFA (133448-20-1 free base)
Cardiac hormone aiding natriuresis, diuresis, vasorelaxation; regulates cardio homeostasis and heart function.Formule :C146H239N47O44S3·C2HF3O2Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :3566.96Bradykinin (1-7)
CAS :Bradykinin (1-7), an amino-truncated peptide derived from Bradykinin, is a metabolite formed through enzymatic cleavage by endopeptidase.Formule :C35H52N10O9Degré de pureté :98%Couleur et forme :White Lyophilized PowderMasse moléculaire :756.85BAM-22P
CAS :Bovine adrenal medulla docosapeptide (BAM-22P) is a potent opioid agonist, derived from the proenkephalin A gene, which is present in the adrenal medulla.Formule :C130H184N38O31S2Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :2839.22BAM 22P acetate
<p>BAM 22P acetate is a potent opioid agonist.</p>Formule :C132H188N38O33S2Degré de pureté :99.87%Couleur et forme :SoildMasse moléculaire :2899.27N-Boc-Phe-Leu-Phe-Leu-Phe
CAS :Boc-FLFLF is an FPR1 antagonist that enhances pain and blocks annexin's antinociception, used in FPR studies.Formule :C44H59N5O8Degré de pureté :>99.99%Couleur et forme :SolidMasse moléculaire :785.97β-Amyloid 15-21
β-amyloid (15-21) is a fragment of Amyloid-β peptide, maybe used in the research of neurological disease. This fragment is involved in beta sheet formation.Formule :C43H65N9O9Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :852.03β-Amyloid 15-21 acetate
β-Amyloid 15-21 acetate (Beta-Amyloid (15-21) acetate) is a fragment of Amyloid-β peptide, maybe used in the research of neurological disease.Formule :C45H69N9O11Degré de pureté :99.62%Couleur et forme :SolidMasse moléculaire :912.1Abaloparatide TFA
Abaloparatide TFA (BIM 44058 TFA) is a parathyroid hormone-related protein (PTHrP) analog drug used to treat osteoporosis like the related drug teriparatide.Formule :C176H301N56F3O51Degré de pureté :99.76%Couleur et forme :SolidMasse moléculaire :4074.61Abaloparatide acetate(247062-33-5 free base)
<p>Abaloparatide acetate is a parathyroid hormone receptor 1 PTHR1 analogue and an effective and selective activator of the PTHR1 signaling pathway.</p>Formule :C176H304N56O51Degré de pureté :95.66%Couleur et forme :SolidMasse moléculaire :4020.71CaM kinase II inhibitor TFA salt
<p>CaM kinase II inhibitor TFA salt (Autocamtide-2-related inhibitory peptide (TFA)) is a highly specific and potent inhibitor of CaMKII with an IC50 of 40 nM.</p>Formule :C66H117F3N22O21Degré de pureté :>99.99%Couleur et forme :SolidMasse moléculaire :1611.77Autocamtide 2
CAS :<p>Autocamtide-2: Selective peptide for CaMKII, a CAMK Ser/Thr kinase.</p>Formule :C65H118N22O20Degré de pureté :98%Couleur et forme :White PowderMasse moléculaire :1527.77Autocamtide 2 TFA(129198-88-5 free base)
<p>Autocamtide 2 TFA, selective CaMKII peptide substrate, used in its activity assay.</p>Formule :C67H119F3N22O22Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :1641.79Atrial natriuretic factor (1-28) (rat) TFA
ANP (1-28), rat (TFA) inhibits Ang II-induced endothelin-1 secretion; main circulating ANP form in rats.Formule :C130H206N45F3O41S2Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :3176.43Atrial Natriuretic Peptide (ANP) (1-28), human, porcine Acetate
CAS :Atrial Natriuretic Peptide (ANP) (1-28), human, porcine Acetate is an NPR-A agonist and ANP hormone. Carperitide increases cGMP levels and reduces the heart's workload.Formule :C129H207N45O41S3Degré de pureté :99.78%Couleur et forme :SoildMasse moléculaire :3140.5ANP(1-28) Acetate (human, porcine)
CAS :<p>Carperitide acetate: 28-amino acid hormone from human heart, counters cardiac injury/stretch, reduces endothelin-1.</p>Formule :C129H207N45O41S3Degré de pureté :98.24%Couleur et forme :SolidMasse moléculaire :3140.5Atrial Natriuretic Peptide (ANP) (1-28), rat
CAS :Atrial Natriuretic Peptide (1-28), rat is the major circulating form of ANP in rats.Formule :C128H205N45O39S2Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :3062.41Apamin TFA (24345-16-2 free base)
Apamin TFA: bee venom toxin; blocks Ca2+-activated K+ channels (SK, KCa2), strongest on SK2.Formule :C81H132F3N31O26S4Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :2141.36Apamin
CAS :<p>Apamin: 18-amino acid bee venom peptide, blocks SK channels, anti-inflammatory, anti-fibrotic, strongly basic.</p>Formule :C79H131N31O24S4Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :2027.34Apamin acetate
<p>Apamin acetate: Selective Ca2+-activated K+ channel blocker, 18-amino acid bee venom peptide, promotes synapse repair, anti-inflammatory.</p>Degré de pureté :96.97%Couleur et forme :Solid[Sar1, Ile8]-Angiotensin II TFA
[Sar1,Ile8]-Angiotensin II (TFA) contracts arteries and affects cell growth in vascular muscle.Formule :C48H74F3N13O12Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :1082.18β-Amyloid (22-35)
CAS :β-Amyloid (22-35) is a 14-aa peptide, shows aggregates and induces neurotoxicity in the hippocampal cells.Formule :C59H102N16O21SDegré de pureté :98%Couleur et forme :SolidMasse moléculaire :1403.62β-Amyloid (1-28)
CAS :β-Amyloid (1-28) is a β-Amyloid protein fragment involved in metal binding.Formule :C145H209N41O46Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :3262.51β-Amyloid (12-28)
CAS :Amyloid β-peptide fragment; minimum section required to bind to brain proteins.Formule :C89H135N25O25Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :1955.18β-Amyloid (1-16)
CAS :β-Amyloid (1-16) is an amyloidogenic protein fragment with a sequence derived from β-amyloid.Formule :C84H119N27O28Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :1955.04β-Amyloid (1-15)
CAS :β-Amyloid (1-15) (Amyloid β-Protein (1-15)) is a fragment of β-amyloid protein used in the study of Alzheimer's disease.Formule :C78H107N25O27Degré de pureté :99.88%Couleur et forme :SolidMasse moléculaire :1826.84β-Amyloid (1-42), rat/mouse
CAS :<p>β-Amyloid (1-42), rat/mouse is a polypeptide composed of 42 amino acids. It is toxic to hippocampal slices and can be used in the study of alzheimer's disease.</p>Formule :C199H307N53O59SDegré de pureté :98%Couleur et forme :SolidMasse moléculaire :4418.02β-Amyloid (29-40)
CAS :<p>β-Amyloid (29-40) is a fragment of Amyloid-β peptide.Alzheimer's beta amyloid peptide (29-40/42) C-terminal fragments have physical and chemical properties</p>Formule :C49H88N12O13SDegré de pureté :98%Couleur et forme :SolidMasse moléculaire :1085.36Amylin, amide, rat
CAS :Amylin: peptide, 50% similar to CGRP, found with somatostatin in stomach cells, reduces acid secretion in mice.Formule :C167H272N52O53S2Degré de pureté :99.92%Couleur et forme :SolidMasse moléculaire :3920.44Amylin, amide, rat acetate(124447-81-0,free base)
Amylin, amide, rat acetate is a potent and high affinity ligand of AMY1 and AMY3 receptors and variably of AMY2 receptors.Formule :C169H276N52O55S2Degré de pureté :98.93%Couleur et forme :SolidMasse moléculaire :3980.45Amylin (8-37), rat
CAS :Amylin (8-37), rat, an analog of IAPP, blocks insulin's effects on muscle glucose uptake and glycogen storage.Formule :C140H227N43O43Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :3200.61Amlodipine aspartic acid impurity
CAS :Amlodipine aspartic acid: a calcium blocker with antihypertensive effects; contains specific impurities.Formule :C24H29ClN2O9Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :524.95Etelcalcetide
CAS :<p>Etelcalcetide (AMG 416), a synthetic peptide CaSR activator, treats secondary hyperparathyroidism in hemodialysis patients.</p>Formule :C38H73N21O10S2Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :1048.26Etelcalcetide hydrochloride
CAS :<p>Etelcalcetide HCl, a synthetic peptide modulator of CaSR, lowers PTH in dialysis patients with secondary hyperparathyroidism.</p>Formule :C38H73N21O10S2HClDegré de pureté :>99.99%Couleur et forme :SolidMasse moléculaire :1353.33ACTH (1-14) TFA (25696-21-3 free base)
<p>ACTH (1-14) (TFA) is a polypeptide of corticotrophin, which promotes the release of cortisol.</p>Formule :C79H110F3N21O22SDegré de pureté :98%Couleur et forme :SolidMasse moléculaire :1794.9ACTH (1-14)
CAS :ACTH (1-14) is a pituitary hormone fragment that controls cortisol and androgen levels.Formule :C77H109N21O20SDegré de pureté :98%Couleur et forme :SolidMasse moléculaire :1680.88ACTH 1-14 acetate(25696-21-3 free base)
<p>ACTH 1-14 acetate regulates cortisol and androgen, is part of the hypothalamic-pituitary-adrenal stress response.</p>Formule :C79H113N21O22SDegré de pureté :>99.99%Couleur et forme :SolidMasse moléculaire :1740.96ACTH (18-39) TFA (human)
CAS :<p>Adrenocorticotropic Hormone (ACTH) (18-39), human TFA (CLIP human TFA) is a corticotropinlike intermediate lobe peptide, produced by melanotropic cells.</p>Formule :C114H166F3N27O38Degré de pureté :>99.99%Couleur et forme :SolidMasse moléculaire :2579.69Adrenocorticotropic Hormone (ACTH) (18-39), human
CAS :ACTH (18-39), or Corticotropin-like Peptide, boosts insulin, amylase, and protein secretion dose-dependently.Formule :C112H165N27O36Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :2465.671-39-Corticotropin (human)(TFA)
ACTH (1-39) human (TFA) is a melanocortin agonist that boosts adrenal CS production and affects the CNS and immune system.Formule :C207H308N56O58S·C2HF3O2Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :4655.16Adrenocorticotropic Hormone (ACTH) (1-10), human
CAS :<p>ACTH (1-10), human: a weak α-MSH mimic at high doses (100-1000 nM), derived from adrenocorticotropin.</p>Formule :C59H78N16O16SDegré de pureté :98%Couleur et forme :SolidMasse moléculaire :1299.41ACTH (1-10) Acetate (human)
ACTH (1-10), human acetate is a segment of adrenocorticotropin with low α-MSH activity at 100-1000 nM.Formule :C61H82N16O18SDegré de pureté :99.35%Couleur et forme :SolidMasse moléculaire :1359.46ACTH (4-11)
CAS :ACTH (4-11) is a peptide fragment of adrenocorticotropic hormone, a peptide hormone found in the brain that is involved in the biological stress response.Formule :C50H71N15O11SDegré de pureté :98%Couleur et forme :SolidMasse moléculaire :1090.26ACTH 4-11 acetate
ACTH 4-11 acetate, a fragment of adrenocorticotropin, matches α-MSH's sequence and has weak MSH potency at high doses (100-1000 nM).Formule :C52H75N15O13SDegré de pureté :99.21%Couleur et forme :SolidMasse moléculaire :1150.31ACTH (22-39)
CAS :<p>ACTH (22-39) is an adrenocorticotropic hormone (ACTH) fragment and it is the 22-39 sequence of ACTH.</p>Formule :C90H125N19O32Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :1985.06ACTH (22-39) acetate
ACTH (22-39) acetate is a fragment of adrenocorticotropic hormone (ACTH) containing two proline residues at positions 3 and 15 from the N-terminus.Formule :C92H129N19O34Degré de pureté :98.14%Couleur et forme :SolidMasse moléculaire :2045.12ACTH (1-13)
CAS :ACTH (1-13), a 13-amino acid peptide, protects rats' stomachs from ethanol damage; it’s a stress-response hormone from the pituitary.Formule :C75H106N20O19SDegré de pureté :98%Couleur et forme :SolidMasse moléculaire :1623.83ACTH (11-24)
CAS :ACTH (11-24) is an adrenocorticotrophin fragment, stimulates cortisol, and antagonizes ACTH (1-39)/(1-10) in adrenal cells.Formule :C77H134N24O16Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :1652.04ACTH 11-24 acetate(4237-93-8 free base)
CAS :ACTH 11-24 acetate is a cortisol-stimulating adrenocorticotrophin fragment and a competitive antagonist of ACTH 1-39 and 1-10.Formule :C79H138N24O18Degré de pureté :>99.99%Couleur et forme :SolidMasse moléculaire :1712.12Adrenocorticotropic Hormone (ACTH) (1-39), rat
CAS :ACTH (1-39), rat: potent MC2 agonist, forms fragments in vitro, isolated by HPLC, characterized by amino acids and NH2-terminus.Formule :C210H315N57O57SDegré de pureté :98%Couleur et forme :SolidMasse moléculaire :4582.23Acetyl-PHF6 amide(TFA) (878663-43-5 free base)
<p>Acetyl-PHF6 amide TFA is a tau derived hexapeptide.</p>Formule :C40H64F3N9O11Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :903.99Acetyl-PHF6 amide acetate
Acetyl-PHF6 amide acetate(878663-43-5 freebase) (AcPHF6 acetate) is a tau derived hexapeptide.Formule :C40H67N9O11Degré de pureté :>99.99%Couleur et forme :SolidMasse moléculaire :850.01N-terminally acetylated Endomorphin-1
N-terminally acetylated Endomorphin-1 is a modified Endomorphin-1.Formule :C36H40N6O6Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :652.74N-terminally acetylated Endomorphin-1 acetate
<p>N-terminally acetylated Endomorphin-1 acetate (Ac-L-Tyr-L-Pro-L-Trp-L-Phe-CONH2) is a modified Endomorphin-1.</p>Formule :C38H44N6O8Degré de pureté :99.67%Couleur et forme :SolidMasse moléculaire :712.79N-terminally acetylated Leu-enkephalin acetate
N-terminally acetylated Leu-enkephalin is the N-terminally acetylated form of Leu-enkephalin.Formule :C30H39N5O8Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :N/AArgireline
CAS :Argireline (Acetyl hexapeptide-3) is a peptide that inhibits neurotransmitter release, reducing wrinkles.Formule :C34H60N14O12SDegré de pureté :96.79% - 99.65%Couleur et forme :White PowderMasse moléculaire :888.99[Met5]-Enkephalin, amide TFA
[Met5]-Enkephalin, amide TFA (5-Methionine-enkephalin amide (TFA)) is a δ opioid receptors agonist as well as putative ζ (zeta) opioid receptors.Formule :C29H37F3N6O8SDegré de pureté :99.81%Couleur et forme :SolidMasse moléculaire :686.7[Met5]-Enkephalin, amide
CAS :[Met5]-Enkephalin, amide activates δ and ζ opioid receptors; has multiple forms and varying plasma levels.Formule :C27H36N6O6SDegré de pureté :98%Couleur et forme :SolidMasse moléculaire :572.68Adrenomedullin (AM) (22-52), human TFA
<p>Adrenomedullin (AM) human (22-52) is a truncated NH2 TFA-modified adrenal medullary receptor antagonist.</p>Formule :C161H253N46F3O50Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :3690.06Adrenomedullin (AM) (22-52), human
CAS :<p>Adrenomedullin (ADM) is a 52-aa hypotensive peptide. Adrenomedullin (ADM) has structural similarity with amylin.</p>Formule :C159H252N46O48Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :3576.04Adrenomedullin (AM) (22-52), human acetate
Adrenomedullin (AM) (22-52), human acetate is an antagonist of calcitonin generelated peptide receptor in the hindlimb vascular bed of the cat and anFormule :C161H256N46O50Degré de pureté :99.42%Couleur et forme :SolidMasse moléculaire :3636.09Somatostatin-28 (1-12)
CAS :Somatostatin-28 (1-12) is a somatostatin fragment which is monitored in brain tissue to track processing of somatostatin.Formule :C49H81N17O19SDegré de pureté :98%Couleur et forme :SolidMasse moléculaire :1244.33[pTyr1146][pTyr1150][pTyr1151]Insulin Receptor (1142-1153)
CAS :Insulin Receptor (1142-1153) binds insulin, is a substrate for its kinase, and has research/medical potential.Formule :C72H110N19O33P3Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :1862.67
![[bAla8]-Neurokinin A(4-10)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP1100.webp&w=3840&q=75)
![[Leu5]-Enkephalin, amide acetate](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP1113L.webp&w=3840&q=75)
![[Met5]-Enkephalin, amide TFA](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP1254.webp&w=3840&q=75)
![[Met5]-Enkephalin, amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP1255.webp&w=3840&q=75)
![[pTyr1146][pTyr1150][pTyr1151]Insulin Receptor (1142-1153)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP1259.webp&w=3840&q=75)