CAS 118997-30-1

peptide yy umano

Descrizione:

Il peptide YY (PYY) è un neuropeptide prodotto principalmente nel tratto gastrointestinale, in particolare nell'ileo e nel colon, in risposta all'assunzione di cibo. Svolge un ruolo cruciale nella regolazione dell'appetito e dell'equilibrio energetico inibendo la motilità gastrica e promuovendo la sazietà. La forma umana del PYY, identificata dal numero CAS 118997-30-1, è composta da 36 aminoacidi ed è strutturalmente correlata ad altri neuropeptidi come il neuropeptide Y (NPY) e il polipeptide pancreatico (PP). Il PYY viene rilasciato postprandialmente, il che significa che i suoi livelli aumentano dopo aver mangiato, e agisce su recettori specifici nel cervello per ridurre i segnali di fame. Inoltre, il PYY è stato implicato in vari processi fisiologici, inclusa la modulazione della secrezione di insulina e della funzione gastrointestinale. Le sue potenziali applicazioni terapeutiche sono in fase di esplorazione nel contesto dell'obesità e dei disturbi metabolici, poiché migliorare la segnalazione del PYY potrebbe aiutare nella regolazione dell'appetito e nella gestione del peso. In generale, il PYY è un attore significativo nella complessa rete di ormoni che governano l'omeostasi energetica.

Formula: C₁₉₄H₂₉₅N₅₅O₅₇

Sinonimi:

• H-Tyr-Pro-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2
• Peptide YY (human)
• Peptide Yy, Human
• Peptide YY (human) Acetate
• PYY, Tyr-Pro-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2
• PubChem ID: 126455957
• TYR-PRO-ILE-LYS-PRO-GLU-ALA-PRO-GLY-GLU-ASP-ALA-SER-PRO-GLU-GLU-LEU-ASN-ARG-TYR-TYR-ALA-SER-LEU-ARG-HIS-TYR-LEU-ASN-LEU-VAL-THR-ARG-GLN-ARG-TYR-NH2
• PEPTIDE YY, HUMAN USP/EP/BP
• Peptide YY (human)|Peptide YY, PYY, human
• PYY (HUMAN)
• PEPTIDE YY PYY HUMAN
• YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2
• Peptide YY human, ≥97% (HPLC)
• M.W. 4309.75 C194H295N55O57
• H-Tyr-Pro-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2 acetate salt
• Human peptide YY

Peptide YY (human)

CAS: 118997-30-1

Peptide YY has been isolated from human colonic extracts. It is identical in sequence to porcine PYY except for two amino acid replacements.

Formula: C₁₉₄H₂₉₅N₅₅O₅₇

Purezza: > 95%

Colore e forma: White Powder

Peso molecolare: 4309.81

Ref: 01-4013882

Peptide YY (human)

CAS: 118997-30-1

Formula: C₁₉₄H₂₉₅N₅₅O₅₇

Purezza: 97%

Peso molecolare: 4309.7524

Ref: IN-DA008RSH

Peptide YY (PYY), human

CAS: 118997-30-1

PYY: a 36-amino-acid hormone, amidated, part of neuroendocrine control, acts via Neuropeptide Y receptors.

Formula: C₁₉₄H₂₉₅N₅₅O₅₇

Purezza: 98%

Colore e forma: Solid

Peso molecolare: 4309.75

Ref: TM-TP1762

Peptide YY (human) trifluoroacetate salt

CAS: 118997-30-1

Peptide YY (PYY) is a 36-amino acid peptide that is secreted by the gut. PYY is a potent inhibitor of food intake and glucose homeostasis in rats and may be involved in the regulation of lipid metabolism. The trifluoroacetate salt form of PYY has been shown to have improved solubility, stability, and bioavailability. It has also been found to be more selective for the PYY receptor than other forms of PYY. The trifluoroacetate salt form of PYY remains stable to phase chromatography under acidic conditions but degrades at higher pH levels.

Formula: C₁₉₄H₂₉₅N₅₅O₅₇

Purezza: Min. 95%

Peso molecolare: 4,309.75 g/mol

Ref: 3D-FP110394