CAS 12279-41-3

Seractide

Descrizione:

Seractide, con il numero CAS 12279-41-3, è un composto chimico conosciuto principalmente per la sua applicazione nel campo della farmacologia e della biochimica. È un tensioattivo sintetico che presenta proprietà come emulsificazione, bagnabilità e dispersione, rendendolo utile in varie formulazioni. Seractide è spesso utilizzato nella preparazione di sistemi di somministrazione di farmaci, migliorando la solubilità e la biodisponibilità di composti poco solubili. La sua natura anfifilica gli consente di interagire con sostanze sia idrofile che idrofobiche, facilitando la stabilizzazione di emulsioni e sospensioni. Inoltre, Seractide può possedere attività biologica, contribuendo al suo ruolo nel migliorare l'efficacia degli agenti terapeutici. Le precauzioni di sicurezza e di manipolazione sono essenziali quando si lavora con questo composto, come con molti tensioattivi, a causa delle potenziali proprietà irritanti. In generale, Seractide è uno strumento prezioso nelle formulazioni farmaceutiche e nella ricerca, contribuendo ai progressi nelle tecnologie di somministrazione dei farmaci.

Formula: C₂₀₇H₃₀₈N₅₆O₅₈S₁

Sinonimi:

• L-Seryl-L-tyrosyl-L-seryl-L-methionyl-L-alpha-glutamyl-L-histidyl-L-phenylalanyl-L-arginyl-L-tryptophylglycyl-L-lysyl-L-prolyl-L-valylglycyl-L-lysyl-L-lysyl-L-arginyl-L-arginyl-L-prolyl-L-valyl-L-lysyl-L-valyl-L-tyrosyl-L-prolyl-L-asparaginylglycyl-L-alanyl-L-alpha-glutamyl-L-alpha-aspartyl-L-alpha-glutamyl-L-seryl-L-alanyl-L-alpha-glutamyl-L-alanyl-L-phenylalanyl-L-prolyl-L-leucyl-L-alpha-glutamyl-L-phenylalanine
• Acth(1-39)
• CORTICOTROPIN (HUMAN)
• ACTH (1-39), HUMAN
• Seractide USP/EP/BP
• H-SER-TYR-SER-MET-GLU-HIS-PHE-ARG-TRP-GLY-LYS-PRO-VAL-GLY-LYS-LYS-ARG-ARG-PRO-VAL-LYS-VAL-TYR-PRO-ASN-GLY-ALA-GLU-ASP-GLU-SER-ALA-GLU-ALA-PHE-PRO-LEU-GLU-PHE-OH
• ADRENOCORTICOTROPIC HORMONE (1-39) (HUMAN)
• Seractide
• CORTICOTROPIN A
• REF DUPL: Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe
• ACTH (1-39) (huMan)
• Adrenocorticotropic hormone fragment 1-39, ≥97% (HPLC)
• SER-TYR-SER-MET-GLU-HIS-PHE-ARG-TRP-GLY-LYS-PRO-VAL-GLY-LYS-LYS-ARG-ARG-PRO-VAL-LYS-VAL-TYR-PRO-ASN-GLY-ALA-GLU-ASP-GLU-SER-ALA-GLU-ALA-PHE-PRO-LEU-GLU-PHE
• ACTH (1-39) (human) trifluoroacetate salt H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe-OH trifluoroacetate salt
• Adrenocorticotropic Hormone (ACTH) (1-39)
• H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe-OH
• Seractide ACTH
• Adrenocorticotropic Hormone (ACTH) (1-39), human
• Seractide acetate
• PCorticotropin (Human) CAS 12279-41-3
• ACTH
• M.W. 4541.07 C207H308N56O58S
• CORTICOTROPHIN
• Corticotropin
• adrenocorticotropic hormone fragment 1-39
• SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
• SER-TYR-SER-MET-GLU-HIS-PHE-ARG-TRP-GLY-LYS-PRO-VAL-GLY-LYS-LYS-ARG-ARG-PRO-VAL-LYS-VAL-TYR-PRO-ASN-GLY-ALA-GLU-ASP-GLU-SER-ALA-GLU-ALA-PHE-PRO-LEU-GLU-PHE HUMAN
• ADRENOCORTICOTROPIC HORMONE HUMAN

ACTH (1-39) (human)

CAS: 12279-41-3

The major regulator of adrenal cortex function. ACTH stimulates the synthesis of steroidal hormones.

Formula: C₂₀₇H₃₀₈N₅₆O₅₈S

Purezza: 99.2%

Colore e forma: White

Peso molecolare: 4541.13

Ref: 01-4030325

a1-39-Corticotropin (human)

CAS: 12279-41-3

Formula: C₂₀₇H₃₀₈N₅₆O₅₈S

Purezza: 98%

Colore e forma: Solid

Peso molecolare: 4541.0658

Ref: IN-DA01CP9W

ACTH (1-39) human

CAS: 12279-41-3

Adrenocorticotropic Hormone (ACTH) (1-39), human (ACTH (1-39), human) is an agonist of melanocortin receptor.

Formula: C₂₀₇H₃₀₈N₅₆O₅₈S

Purezza: 99.6%

Colore e forma: White Lyophilised Solid

Peso molecolare: 4541.14

Ref: TM-T8231

ACTH(1-39) trifluoroacetate

CAS: 12279-41-3

ACTH(1-39) trifluoroacetate is a synthetic form of ACTH that is used for the diagnosis of autoimmune diseases and bowel disease. It is also used to assess the function of the adrenal gland in cases of suspected Cushing's syndrome. The blood sampling procedure involves withdrawing a small amount of blood from the patient and adding ACTH(1-39) trifluoroacetate to it, which causes an increase in cortisol concentration. ACTH(1-39) trifluoroacetate binds to corticotropin receptors on cells in the body, causing them to release basic proteins that are responsible for inflammation. This drug may be a potential biomarker for metabolic disorders such as obesity. It has been shown to have anti-inflammatory properties and can be used as a nonsteroidal anti-inflammatory drug (NSAID).

Formula: C₂₀₇H₃₀₈N₅₆O₅₈S

Purezza: Min. 98 Area-%

Colore e forma: Powder

Peso molecolare: 4,541.07 g/mol

Ref: 3D-FA108368