CAS 133514-43-9
:frammento di exendina 9-39
Descrizione:
frammento di exendina 9-39 è un peptide derivato dalla molecola exendina-4, che è un analogo del peptide-1 simile al glucagone (GLP-1). Questo frammento specifico è noto per il suo ruolo di antagonista competitivo del recettore GLP-1, che è significativo nella regolazione del metabolismo del glucosio e nella secrezione di insulina. Il peptide è composto da 31 aminoacidi ed è caratterizzato dalla sua capacità di inibire le azioni del GLP-1, rendendolo un argomento di interesse nella ricerca sul diabete e nelle potenziali applicazioni terapeutiche. La sua struttura include una sequenza che gli consente di legarsi al recettore GLP-1, ma a differenza del GLP-1, non attiva il recettore, bloccando così i suoi effetti. Il numero CAS 133514-43-9 identifica univocamente questo composto nelle banche dati chimiche, facilitando il suo studio e la sua applicazione in contesti farmacologici. In generale, frammento di exendina 9-39 serve come uno strumento prezioso per comprendere la segnalazione del recettore GLP-1 e le sue implicazioni nei disturbi metabolici.
Formula:C149H234N40O47S
Sinonimi:- Exendin (9-39)
- Exendin(9-39)amide
- Exendin 3 (heloderma horridum), 1-de-L-histidine-2-de-L-serine-3-de-L-aspartic acid-4-deglycine-5-de-L-threonine-6-de-L-phenylalanine-7-de-L-threonine-8-de-L-serine-
- H-ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2
- Exendin-3 (9-39) amide USP/EP/BP
- H-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2 acetate salt
- Exendin Fragment 9-39 >=95% (HPLC)
- 9-39-Exendin 3(Heloderma horridum) (9CI)
- EXENDIN-3 (9-39) AMIDE
- H-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
- 9-39-Exendin 3(Heloderma horridum)
- DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
- L-Serinamide, L-α-aspartyl-L-leucyl-L-seryl-L-lysyl-L-glutaminyl-L-methionyl-L-α-glutamyl-L-α-glutamyl-L-α-glutamyl-L-alanyl-L-valyl-L-arginyl-L-leucyl-L-phenylalanyl-L-isoleucyl-L-α-glutamyl-L-tryptophyl-L-leucyl-L-lysyl-L-asparaginylglycylglycyl-L-prolyl-L-seryl-L-serylglycyl-L-alanyl-L-prolyl-L-p...
- Exendin 4 (9-39) amide
- ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2: DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
- M.W. 3369.79 C149H234N40O47S
- Exendin FragMent 9-39Exendin
- ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2
- EXENDIN [9-39] PEPTIDE
- EXENDIN FRAGMENT 9-39
- EXENDIN FRAGMENT 9-39;EXENDIN (9-39)
- Asp-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRp-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2, ≥95%(HPLC)
- Exendin (9-39) Acetate
- Vedi altri sinonimi
Ordinare per
Purezza (%)
0
100
|
0
|
50
|
90
|
95
|
100
7 prodotti.
Exendin (9-39)
CAS:For cellular and molecular biology applicationsFormula:C149H234N40O47SPeso molecolare:3369.75Exendin (9-39)
CAS:Exendin (9-39) is a potent glucagon-like peptide 1 (GLP-1) receptor antagonist. It has also been described as an antagonist of the putative exendin receptor. Exendin (9-39) blocks the stimulatory action of GLP-1 (7- 36) amide and of exendin-4 on cAMP production in pancreatic acini. Moreover, exendin (9-39) was shown to be safely used to abolish the incretin effect of GLP-1 without interfering with the control of insulin secretion by circulating nutrients.Formula:C149H234N40O47SPurezza:97.4%Colore e forma:White PowderPeso molecolare:3369.8Exendin Fragment 9-39
CAS:Formula:C149H234N40O47SPurezza:≥ 95.0%Colore e forma:White powderPeso molecolare:3369.75Avexitide
CAS:Avexitide (Exendin-3 (9-39) amide) (Exendin (9-39)) is a specific and competitive antagonist of glucagon-like peptide-1 (GLP-1) receptor.Formula:C149H234N40O47SPurezza:98% - 99.65%Colore e forma:SolidPeso molecolare:3369.76Exendin (9-39)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C149H234N40O47SPeso molecolare:3,369.79 g/molExendin (9-39) acetate
CAS:Exendin (9-39) acetate is a peptide hormone that is derived from the salivary gland of the Gila monster. It binds to receptors in the pancreas and inhibits insulin release. Exendin (9-39) acetate has been shown to increase glomerular filtration rate, natriuresis, and plasma glucose levels in animals. This peptide also increases soluble guanylate cyclase activity, which leads to an increase in cellular cGMP levels and vasodilation. Exendin (9-39) acetate has been shown to inhibit the production of cyclic guanosine monophosphate (cGMP) by inhibiting adenylyl cyclase activity. It also binds to receptors on pancreatic beta cells and inhibits insulin release, as well as binding to receptors on vascular smooth muscle cells and causing vasodilation.Formula:C149H234N40O47SPurezza:Min. 95%Peso molecolare:3,369.76 g/mol






