
CAS 159002-68-3
:GLUCAGONE-37 (UMANO, TOPO, RATTO)
Descrizione:
Il glucagone-37 è un ormone peptidico che svolge un ruolo cruciale nel metabolismo del glucosio ed è prodotto principalmente dalle cellule alfa del pancreas. È un polipeptide di 37 aminoacidi, che è un membro della famiglia degli ormoni del glucagone. Questa sostanza è coinvolta nell'aumento dei livelli di glucosio nel sangue promuovendo la gluconeogenesi e la glicogenolisi nel fegato. Il glucagone-37 è particolarmente significativo nel contesto della regolazione metabolica ed è studiato per le sue potenziali implicazioni nella gestione del diabete. Il numero CAS 159002-68-3 identifica specificamente questo peptide, che è rilevante per la ricerca e le applicazioni farmaceutiche. In termini delle sue caratteristiche biochimiche, il glucagone-37 mostra un alto grado di specificità per il suo recettore, il recettore del glucagone, che è un recettore accoppiato a proteine G. Questa interazione innesca una cascata di vie di segnalazione intracellulare che alla fine portano alla mobilizzazione delle riserve energetiche. Comprendere la struttura e la funzione del glucagone-37 è essenziale per sviluppare strategie terapeutiche per i disturbi metabolici.
- Oxm (Human, Mouse, Rat)
- Oxyntomodulin (Human, Mouse, Rat)
- Preproglucagon (53-89) (Human, Mouse, Rat)
- Proglucagon (33-69) (Human, Mouse, Rat)
- H-His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr-Lys-Arg-Asn-Arg-Asn-Asn-Ile-Ala-Oh
Ordinare per
Purezza (%)
0
100
|
0
|
50
|
90
|
95
|
100
3 prodotti.
Oxyntomodulin (human, mouse, rat)
CAS:Oxyntomodulin potently inhibits gastric acid secretion and pancreatic enzyme secretion when infused iv. Moreover, it was shown that intracerebroventricularly and into the hypothalamic paraventricular nucleus injected oxyntomodulin inhibits food intake in fasted and nonfasted animals potently and in a sustained manner.Formula:C192H295N61O60SPurezza:95.3%Colore e forma:White PowderPeso molecolare:4449.9Oxyntomodulin, Glucagon-37 (Human, Mouse, Rat)
CAS:<p>Oxyntomodulin, Glucagon-37 (Human, Mouse, Rat) is an inhibitor of gastric acid secretion and pancreatic enzyme secretion and has been shown to reduce food intake and increase energy expenditure in humans. This product is available in the trifluoroacetate salt form.<br>One letter code: HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA</p>Formula:C192H295N61O60SPurezza:Min. 95%Peso molecolare:4,449.93 g/molOxyntomodulin (human, mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Oxyntomodulin (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C192H295N61O60SPurezza:Min. 95%Peso molecolare:4,449.84 g/mol

