CAS 86784-80-7

fattore di rilascio della corticotropina umano

Descrizione:

Il fattore di rilascio della corticotropina (CRF), specificamente la variante umana con il numero CAS 86784-80-7, è un ormone peptidico coinvolto nella risposta allo stress. È prodotto principalmente nell'ipotalamo e gioca un ruolo cruciale nell'asse ipotalamo-ipofisi-surrene (HPA) stimolando il rilascio dell'ormone adrenocorticotropo (ACTH) dalla ghiandola pituitaria. Il CRF è composto da 41 aminoacidi ed è caratterizzato dalla sua capacità di legarsi a recettori specifici, in particolare ai recettori CRF 1 e 2, che sono coinvolti in vari processi fisiologici, inclusa la risposta allo stress, l'ansia e la regolazione dei ritmi circadiani. La sostanza si trova tipicamente in forma solubile ed è sensibile a condizioni ambientali come temperatura e pH. La sua attività biologica è critica per mantenere l'omeostasi e rispondere agli stressori, rendendola un importante oggetto di ricerca in neurobiologia ed endocrinologia. Inoltre, il CRF ha implicazioni in vari disturbi psichiatrici, evidenziando la sua importanza sia nella salute che nella malattia.

Formula: C₂₀₈H₃₄₄N₆₀O₆₃S₂

InChI: InChI=1/C208H343N59O64S2/c1-30-106(20)161(263-198(323)147-49-41-75-266(147)204(329)148-50-42-76-267(148)203(328)132(59-68-158(286)287)246-179(304)126(55-64-154(278)279)235-169(294)117(210)93-268)200(325)260-146(95-270)197(322)253-137(83-102(12)13)189(314)256-144(90-159(288)289)194(319)252-139(85-104(16)17)195(320)265-164(113(27)271)202(327)258-140(86-114-43-34-33-35-44-114)190(315)254-142(88-116-92-222-97-227-116)191(316)251-136(82-101(10)11)188(313)250-135(81-100(8)9)185(310)237-121(48-40-74-225-208(219)220)175(300)241-128(57-66-156(282)283)182(307)261-160(105(18)19)199(324)257-138(84-103(14)15)187(312)242-127(56-65-155(280)281)178(303)244-130(69-77-332-28)172(297)230-109(23)165(290)232-119(46-38-72-223-206(215)216)170(295)228-110(24)166(291)234-125(54-63-153(276)277)177(302)240-124(53-62-151(213)274)180(305)248-133(79-98(4)5)184(309)231-111(25)167(292)233-123(52-61-150(212)273)176(301)239-122(51-60-149(211)272)171(296)229-112(26)168(293)247-141(87-115-91-221-96-226-115)192(317)259-145(94-269)196(321)255-143(89-152(214)275)193(318)238-120(47-39-73-224-207(217)218)174(299)236-118(45-36-37-71-209)173(298)245-131(70-78-333-29)181(306)249-134(80-99(6)7)186(311)243-129(58-67-157(284)285)183(308)262-162(107(21)31-2)201(326)264-163(205(330)331)108(22)32-3/h33-35,43-44,91-92,96-113,117-148,160-164,268-271H,30-32,36-42,45-90,93-95,209-210H2,1-29H3,(H2,211,272)(H2,212,273)(H2,213,274)(H2,214,275)(H,221,226)(H,222,227)(H,228,295)(H,229,296)(H,230,297)(H,231,309)(H,232,290)(H,233,292)(H,234,291)(H,235,294)(H,236,299)(H,237,310)(H,238,318)(H,239,301)(H,240,302)(H,241,300)(H,242,312)(H,243,311)(H,244,303)(H,245,298)(H,246,304)(H,247,293)(H,248,305)(H,249,306)(H,250,313)(H,251,316)(H,252,319)(H,253,322)(H,254,315)(H,255,321)(H,256,314)(H,257,324)(H,258,327)(H,259,317)(H,260,325)(H,261,307)(H,262,308)(H,263,323)(H,264,326)(H,265,320)(H,276,277)(H,278,279)(H,280,281)(H,282,283)(H,284,285)(H,286,287)(H,288,289)(H,330,331)(H4,215,216,223)(H4,217,218,224)(H4,219,220,225)

SMILES: CCC(C)C(C(=NC(CO)C(=NC(CC(C)C)C(=NC(CC(=O)O)C(=NC(CC(C)C)C(=NC(C(C)O)C(=NC(Cc1ccccc1)C(=NC(Cc1cnc[nH]1)C(=NC(CC(C)C)C(=NC(CC(C)C)C(=NC(CCCNC(=N)N)C(=NC(CCC(=O)O)C(=NC(C(C)C)C(=NC(CC(C)C)C(=NC(CCC(=O)O)C(=NC(CCSC)C(=NC(C)C(=NC(CCCNC(=N)N)C(=NC(C)C(=NC(CCC(=O)O)C(=NC(CCC(=N)O)C(=NC(CC(C)C)C(=NC(C)C(=NC(CCC(=N)O)C(=NC(CCC(=N)O)C(=NC(C)C(=NC(Cc1cnc[nH]1)C(=NC(CO)C(=NC(CC(=N)O)C(=NC(CCCNC(=N)N)C(=NC(CCCCN)C(=NC(CCSC)C(=NC(CC(C)C)C(=NC(CCC(=O)O)C(=NC(C(C)CC)C(=NC(C(C)CC)C(=O)O)O)O)O)O)O)O)O)O)O)O)O)O)O)O)O)O)O)O)O)O)O)O)O)O)O)O)O)O)O)O)O)O)O)O)O)N=C(C1CCCN1C(=O)C1CCCN1C(=O)C(CCC(=O)O)N=C(C(CCC(=O)O)N=C(C(CO)N)O)O)O

Sinonimi:

• Corticotropin-Releasing Factor, Human and Rat
• Crf (Human, Rat)
• Corticotropin-Releasing Factor, human, rat
• corticotropin-releasinghormone(human)
• humancrf(1-41)
• H-SER-GLU-GLU-PRO-PRO-ILE-SER-LEU-ASP-LEU-THR-PHE-HIS-LEU-LEU-ARG-GLU-VAL-LEU-GLU-MET-ALA-ARG-ALA-GLU-GLN-LEU-ALA-GLN-GLN-ALA-HIS-SER-ASN-ARG-LYS-LEU-MET-GLU-ILE-ILE-NH2
• CRF(human,Rat) Acetate
• Corticotropin-releasing factor (sheep), 2-L-glutamic acid-22-L-alanine-23-L-arginine- 25-L-glutamic acid-38-L-methionine-39-L-glutamic acid-41-L-isoleucinamide-
• CRH
• ratcorticotropin-releasingfactor-41
• Corticotropin-releasing Factor TFA Salt (Human, rat) (Technical Grade)
• H-Ser-Glu-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Ala-Arg-Ala-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Met-Glu-Ile-Ile-NH2 acetate salt
• SER-GLU-GLU-PRO-PRO-ILE-SER-LEU-ASP-LEU-THR-PHE-HIS-LEU-LEU-ARG-GLU-VAL-LEU-GLU-MET-ALA-ARG-ALA-GLU-GLN-LEU-ALA-GLN-GLN-ALA-HIS-SER-ASN-ARG-LYS-LEU-MET-GLU-ILE-ILE-NH2
• humancorticotropin-releasinghormone
• CorticotropinReleasingFactorhuMan,rat,CorticotropinReleasingFactorhuMan
• mci028
• CORTICOTROPIN RELEASING FACTOR (CRF), HUMAN, RAT
• CORTICOTROPIN RELEASING FACTOR, HUMAN
• Rat/human corticotropin-releasing factor
• corticotropin-releasingfactor(rat)
• CRF-41, CRH, Corticoliberin, Corticorelin
• ratacth-releasinghormone
• humancorticotropin-releasinghormone-41
• CRF (HUMAN, RAT) USP/EP/BP
• (Human CRF)
• rathypothalamiccrf
• Corticotropin-releasing factor (human)
• CRF (human, rat) acetate salt
• corticobiss
• SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2
• Ser-Glu-Glu-Pro-Pro-IleSer-Leu-Asp-Leu-Thr-Phe-His-Leu-Arg-Glu-Val-Leu-Glu-Met-Ala-Arg-Ala-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Met-Glu-Ile-Ile-NH2
• Corticotropin Releasing Factor, Human and Rat - CAS 86784-80-7 - Calbiochem
• crf41
• humancrf
• ratcorticotropin-releasingfactor
• humancorticotropin-releasingfactor
• corticotropin-releasingfactor(horse)
• corticotropin-releasingfactor(sheep),2-l-glutamicacid-22-l-alanine-23-l-arg
• ratcrf
• Corticotropin Releasing Factor human, rat, ≥95% (HPLC)
• ratcrf(1-41)
• CORTICOTROPIN RELEASING FACTOR
• M.W. 4757.45 C208H344N60O63S2
• CRF Acetate
• CRF, HUMAN AND RAT
• CRF(human,rat), CRH
• inine-25-l-glutamicacid-38-l-methionine-39-l-glutamicacid-41-l-isoleucinamid

Corticotropin-Releasing Factor, human, rat

CAS: 86784-80-7

Corticotropin-Releasing Factor, human, rat

Colore e forma: White powder

Ref: 02-J66835

CRF (human, rat)

CAS: 86784-80-7

CRF (corticotropin-releasing factor) is a 41-peptide produced mainly in the hypothalamus. The peptide hormone stimulates ACTH release from the anterior lobe of the pituitary gland. CRH plays an important role in the endocrine, behavioral, and immune response to stress and probably as well in the regulation of energy balance. The human sequence EEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII amide also corresponds to the sequence of canine, feline, murine, and porcine CRH.

Formula: C₂₀₈H₃₄₄N₆₀O₆₃S₂

Purezza: ≥ 99%

Colore e forma: White

Peso molecolare: 4757.52

Ref: 01-4011473

Corticotropin-releasing factor (human)

CAS: 86784-80-7

Formula: C₂₀₈H₃₄₄N₆₀O₆₃S₂

Purezza: 95%

Colore e forma: Solid

Peso molecolare: 4757.4512

Ref: IN-DA01CB8Y

CRF (human, rat) Acetate

CAS: 86784-80-7

Ref: 7W-GX6233

Corticotropin-releasing factor (human)

CAS: 86784-80-7

Human CRF is a neuropeptide that releases ACTH, stimulates the nervous system, and antagonizes inflammation.

Formula: C₂₀₈H₃₄₄N₆₀O₆₃S₂

Purezza: 98%

Colore e forma: Solid

Peso molecolare: 4757.45

Ref: TM-TP1144

Corticotropin Releasing Factor

CAS: 86784-80-7

Corticotropin Releasing Factor

Colore e forma: Solid

Ref: 54-BIBA1036

Corticotropin-releasing Factor Trifluoroacetic Acid Salt (Human, rat) (Technical Grade)

Prodotto controllato

CAS: 86784-80-7

Applications Corticotropin-releasing Factor (Human, rat) is a 41-amino-acid neuropeptide responsible for endocrine, autonomic, immunology and behavioral responses of mammals to stress. Corticotropin-releasing Factor (Human, rat) has an inhibitory effect on in vitro fertilized oocytes, resulting from cultured preantral follicles at all stages of preimplantation embryo development
References Dinopoulou, V., et. al.: Endocrin., 154, 222 (2013)

Formula: C₂₀₈H₃₄₄N₆₀O₆₃S₂·xC₂HF₃O₂

Colore e forma: Neat

Peso molecolare: 4757.45

Ref: TR-C695750

CRF (human, rat) acetate

CAS: 86784-80-7

CRF (human, rat) acetate is a synthetic chemical that has been shown to produce long-term changes in the brain. It is chemically similar to CRF, which is an endogenous hormone produced by the hypothalamus. This drug is used for the treatment of cerebral edema and intracranial hypertension caused by various conditions, such as cancer. The effects of CRF (human, rat) acetate on humans are not well understood as this drug has only been tested in women who have undergone surgery to remove their ovaries. These women had increased levels of corticotropin-releasing hormone (CRH), which could be due to CRF (human, rat) acetate or its metabolites. There is also some evidence that it may cause corrosion in long-term use.

Formula: C₂₀₈H₃₄₄N₆₀O₆₃S₂

Purezza: Min. 95%

Colore e forma: White Powder

Peso molecolare: 4,757.46 g/mol

Ref: 3D-FC108671

CRF (human, rat)

CAS: 86784-80-7

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Formula: C₂₀₈H₃₄₄N₆₀O₆₃S₂

Peso molecolare: 4,758 g/mol

Ref: 3D-PP50518

CRF (Human, Rat)

CAS: 86784-80-7

Corticotropin-Releasing Factor (CRF) (Human, Rat) is a peptide hormone product that is available as a 0.5mg vial and has the potential to be used as a research tool to study the effects of CRF in the body. CRF is a natural hormone that regulates many physiological processes, such as blood pressure, temperature control, and food intake. CRF binds to receptors on cells and triggers a number of cellular responses within the cell. This peptide can be used for pharmacological studies or for antibody production.

Formula: C₂₀₈H₃₄₄N₆₀O₆₃S₂

Purezza: Min. 95%

Peso molecolare: 4,757.5 g/mol

Ref: 3D-PCR-4136-V

CRF (Human, Rat)

CAS: 86784-80-7

A (Human, Rat) Corticotropin-Releasing Factor (CRF) product available as a 0.1mg vial. As a peptide hormone CRF regulates the hypothalamic-pituitary adrenal (HPA) axis. The hypothalamus releases CRF during stress and in turn CRF stimulates the production of stress hormones such as glucocorticoids and adrenocorticotropin (ACTH). Glucocorticoids are then involved in a negative feedback loop, in that they prevent the pituitary gland and hypothalamus from exhibiting any further endocrine activity. The overproduction of CRF due to the overstimulation of the hypothalamic-pituitary adrenal axis has been shown to cause symptoms seen in patients with depression. Furthermore studies have shown the expression of CRF receptors in glial cells and T-cells and elevated levels of CRF and glucocorticoids prevent T-cell proliferation. During stress cytokines can also stimulate the secretion of CRF. However CRF can also regulate these cytokines. CRF has the potential to be used in the research into depression treatments.

Formula: C₂₀₈H₃₄₄N₆₀O₆₃S₂

Purezza: Min. 95%

Peso molecolare: 4,757.5 g/mol

Ref: 3D-PCR-4136-S