
Recettore del glucagone
I recettori del glucagone sono GPCR che mediano gli effetti del glucagone, un ormone coinvolto nella regolazione dell'omeostasi del glucosio promuovendo la degradazione del glicogeno e il rilascio di glucosio dal fegato. Questi recettori sono fondamentali nella gestione dei livelli di zucchero nel sangue e sono di particolare interesse nello studio del diabete e dei disturbi metabolici. Gli antagonisti dei recettori del glucagone sono studiati come potenziali trattamenti per l'iperglicemia nel diabete di tipo 2. Presso CymitQuimica, offriamo una varietà di modulatori dei recettori del glucagone di alta qualità per supportare la tua ricerca in endocrinologia, diabete e regolazione metabolica.
Trovati 195 prodotti di "Recettore del glucagone"
Ordinare per
Purezza (%)
0
100
|
0
|
50
|
90
|
95
|
100
Maridebart
CAS:Maridebart is a humanized IgG1-kappa monoclonal antibody that targets the GIPR (gastric inhibitory polypeptide receptor) [1].Colore e forma:LiquidOxyntomodulin
CAS:GLP-1 analog modulates appetite, boosts metabolism, and curbs gastric acid. Increases cAMP, mildly stimulates glucagon receptor.Formula:C192H295N59O60SPurezza:98%Colore e forma:SolidPeso molecolare:4421.86GLP-1 receptor agonist 8
CAS:GLP-1 receptor agonist 8, potent for diabetes and obesity research, may also study NAFLD.Formula:C34H36ClFN6O4Colore e forma:SolidPeso molecolare:647.14[Des-His1,Glu9]-Glucagon amide
CAS:Glucagon blocker with pA2 of 7.2; no agonist effect. Boosts insulin; prevents glucagon-driven hyperglycemia in rabbits and diabetic rats.Formula:C148H221N41O47SPurezza:98%Colore e forma:SolidPeso molecolare:3358.68GLP-1R agonist 27
<p>GLP-1R agonist 27 (compound 21) is a potent and orally active GLP-1R agonist. It enhances the accumulation of cyclic adenosine monophosphate (cAMP), reduces blood glucose levels, and decreases food intake. GLP-1R agonist 27 shows potential for research in obesity and type 2 diabetes mellitus (T2DM).</p>Formula:C32H33N5O4SeColore e forma:SolidPeso molecolare:630.6Liraglutide acetate
CAS:Liraglutide acetate is the acetate salt form of Liraglutide, which is a glucagon-like peptide-1 (GLP-1) receptor agonist, utilized in the study of type 2 diabetes.Formula:C172H265N43O51·xC2H4O2Peso molecolare:3751.20 (free base)(S)-V-0219 hydrochloride
(S)-V-0219 hydrochloride, a GLP-1R PAM, triggers calcium in hGLP-1R HEK cells, lowers glucose in mice, and reduces fasting hunger.Formula:C20H26ClF3N4O2Colore e forma:SolidPeso molecolare:446.89GLP-1R agonist 15
CAS:GLP-1R agonist 15 (Compound 101) is a GLP-1 receptor agonist [1] .Formula:C46H47FN8O7SColore e forma:SolidPeso molecolare:874.98Gulgafafusp alfa
CAS:Gulgafafusp alfa is a human IgG2κ monoclonal antibody that selectively binds to the glucagon-like peptide 1 receptor (GLP1R) [1].Colore e forma:LiquidPHI-27 (porcine)
CAS:PHI-27 (porcine) is a porcine-derived peptide consisting of 27 amino acids, utilized in the identification of peptide hormones and other bioactive peptides [1].Formula:C136H216N36O40Peso molecolare:2995.39DD202-114
CAS:DD202-114 is an effective and selective agonist of GLP1R. It promotes the accumulation of cAMP, reduces blood glucose levels, and decreases food intake. Additionally, DD202-114 holds potential for research in type 2 diabetes mellitus (T2DM) and obesity studies.Formula:C33H35FN4O5Peso molecolare:586.65Glucagon-like peptide 1 (1-37), human TFA
Human Glucagon-like peptide 1 (1-37) TFA is a potent GLP-1 receptor agonist derived from proglucagon.Formula:C188H276N51F3O61Purezza:98%Colore e forma:SolidPeso molecolare:4283.5(Asp28)-Glucagon (1-29) (human, rat, porcine)
CAS:"(Asp28)-Glucagon (1-29) (human, rat, porcine)" is an analog of glucagon with an aspartic acid (Asp) substitution at position 28, notably enhancing its aqueousFormula:C153H224N42O50SPeso molecolare:3483.73GLP-1R agonist 16
CAS:Compound 115a, a GLP-1R agonist, effectively activates the GLP-1 receptor with an EC50 of 0.15 nM [1].Formula:C50H58FN10O6PColore e forma:SolidPeso molecolare:945.03GLP-1R agonist 4
CAS:GLP-1R agonist 4, potentially for diabetes research, is a potent GLP-1R stimulator linked to hypoglycemia.Formula:C32H30ClF2N3O5Colore e forma:SolidPeso molecolare:610.05SAR441255
SAR441255 is a potent unimolecular peptide that acts as a GLP-1/GIP/GCG receptor triagonist, demonstrating balanced activation across all three target receptorsColore e forma:Odour SolidFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Colore e forma:SolidPeso molecolare:3692.15Dapiglutide
CAS:Dapiglutide (ZP7570) is a long-acting GLP-1R & GLP-2R dual agonist for SBS research.Colore e forma:SolidGRPP (human)
CAS:GRPP (human), a 30-amino-acid peptide derived from Gcg, modestly elevates plasma insulin levels while reducing plasma glucagon concentrations.Formula:C136H215N41O58SColore e forma:SolidPeso molecolare:3384.47GLP-1(28-36)amide TFA
GLP-1(28-36)amide TFA, a nonapeptide cleavage product of GLP-1, shows antioxidant properties with anti-diabetic and cardioprotective effects.Formula:C56H86F3N15O11Colore e forma:SolidPeso molecolare:1202.37

