Prodotti biochimici e reagenti
Sottocategorie di "Prodotti biochimici e reagenti"
- Biomolecole(98.678 prodotti)
- Per obiettivo biologico(100.149 prodotti)
- Per uso/effetti farmacologici(6.845 prodotti)
- Composti relativi alla crioconservazione e crioconservanti(21 prodotti)
- Disinfettanti, additivi per fluidi per bagni di riscaldamento e composti correlati(28 prodotti)
- Ormoni(356 prodotti)
- Biologia vegetale(6.910 prodotti)
- Metaboliti secondari(14.344 prodotti)
Trovati 130210 prodotti di "Prodotti biochimici e reagenti"
Ref: 3D-VAC-00670
Prodotto fuori produzionebeta-Amyloid/A4 Protein Precusor (APP) (319-335)
Catalogue peptide; min. 95% purity
Formula:C86H151N31O26S2Peso molecolare:2,099.48 g/molRef: 3D-VAC-00226
Prodotto fuori produzioneItacitinib
CAS:Itacitinib is a Jak1 inhibitor that is used to treat bowel disease. Itacitinib has been shown to inhibit the growth of probiotic bacteria such as Lactobacillus and Bifidobacterium, which are beneficial for intestinal health. Itacitinib also inhibits the production of inflammatory cytokines, such as TNF-α, IL-6, and IL-8, in vitro in human monocytes. This drug has been shown to reduce the severity of bronchiolitis obliterans (a rare lung disease) in vivo in mice. Itacitinib binds to the cell factor on activated T cells and inhibits its signaling pathway. In addition, it blocks PD-L1 expression on tumor cells, thereby preventing tumor cell proliferation and inducing an M2 phenotype (a type of immune response). Finally, itacitinib inhibits Jak2 V617F activity by binding to this enzyme and causes a decrease in disease activity.
Formula:C26H23F4N9OPurezza:Min. 95%Peso molecolare:553.51 g/molbeta-Interleukin II (44-56)
Catalogue peptide; min. 95% purity
Formula:C68H113N19O19Peso molecolare:1,500.77 g/molRef: 3D-VAC-00506
Prodotto fuori produzioneN-(3-Amino-2-hydroxy-3-oxopropyl)-L-valyl-N-phenyl-L-leucinamide
CAS:Please enquire for more information about N-(3-Amino-2-hydroxy-3-oxopropyl)-L-valyl-N-phenyl-L-leucinamide including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C20H32N4O4Purezza:Min. 95%Colore e forma:PowderPeso molecolare:392.49 g/molRef: 3D-FR108333
Prodotto fuori produzioneAmyloid Bri Protein (1-34)
Catalogue peptide; min. 95% purity
Formula:C173H273N49O52S2Peso molecolare:3,935.55 g/molRef: 3D-VAC-00168
Prodotto fuori produzioneDABCYL-(Asn670,Leu671)-Amyloid b/A4 Protein Precursor770 (667-675)-EDANS ammonium salt
CAS:Please enquire for more information about DABCYL-(Asn670,Leu671)-Amyloid b/A4 Protein Precursor770 (667-675)-EDANS ammonium salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C71H91N15O21SPurezza:Min. 95%Peso molecolare:1,522.64 g/molRef: 3D-FD110954
Prodotto fuori produzioneZ-Ile-Val-OH
CAS:Please enquire for more information about Z-Ile-Val-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C19H28N2O5Purezza:Min. 95%Peso molecolare:364.44 g/molRef: 3D-FI111494
Prodotto fuori produzioneBiotin-Kinase Domain of Insulin Receptor (2)
Catalogue peptide; min. 95% purity
Formula:C72H122N21O29SPeso molecolare:1,777.92 g/molRef: 3D-VAC-00122
Prodotto fuori produzioneRef: 3D-VAC-00718
Prodotto fuori produzioneChorionic Gonadotropin-beta(109-119) amide (human)
Catalogue peptide; min. 95% purity
Formula:C51H76N16O21SPeso molecolare:1,269.31 g/molRef: 3D-VAC-00756
Prodotto fuori produzioneKinase Domain of Insulin Receptor (5)
Catalogue peptide; min. 95% purity
Formula:C72H110N19O33Peso molecolare:1,862.77 g/molRef: 3D-VAC-00770
Prodotto fuori produzioneH-Asp-beta-Ala-OH
CAS:Please enquire for more information about H-Asp-beta-Ala-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C7H12N2O5Purezza:Min. 90 Area-%Colore e forma:PowderPeso molecolare:204.18 g/molRef: 3D-FA107994
Prodotto fuori produzioneDynorphin A (2-13), porcine
Catalogue peptide; min. 95% purity
Formula:C66H117N23O13Peso molecolare:1,440.81 g/molRef: 3D-VAC-00416
Prodotto fuori produzioneH-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH
Peptide H-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ref: 3D-PP47266
Prodotto fuori produzioneAloc-DL-Orn (Boc)-OH·DCHA
CAS:Prodotto controllatoPlease enquire for more information about Aloc-DL-Orn (Boc)-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C14H24N2O6·C12H23NPurezza:Min. 95%Peso molecolare:497.67 g/molRef: 3D-FA107927
Prodotto fuori produzione[Val5,Asn9]-Angiotensin I
Catalogue peptide; min. 95% purity
Formula:C59H86N16O15Peso molecolare:1,259.44 g/molRef: 3D-VAC-00346
Prodotto fuori produzioneBiotin-Angiotensin I, human
Catalogue peptide; min. 95% purity
Formula:C72H103N19O16SPeso molecolare:1,522.81 g/molRef: 3D-VAC-00084
Prodotto fuori produzioneTachykinin (111-129) Beta-Prepro (Human)
Catalogue peptide; min. 95% purity
Formula:C96H156N34O31SPeso molecolare:2,314.59 g/molRef: 3D-VAC-00234
Prodotto fuori produzionebeta-Defensin-3, human
Catalogue peptide; min. 95% purity
Formula:C216H371N75O59S6Peso molecolare:5,155.22 g/molRef: 3D-VAC-00429
Prodotto fuori produzione
![[Val5,Asn9]-Angiotensin I](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00346.webp&w=3840&q=75)
