Prodotti biochimici e reagenti
Sottocategorie di "Prodotti biochimici e reagenti"
- Biomolecole(98.678 prodotti)
- Per obiettivo biologico(100.149 prodotti)
- Per uso/effetti farmacologici(6.845 prodotti)
- Composti relativi alla crioconservazione e crioconservanti(21 prodotti)
- Disinfettanti, additivi per fluidi per bagni di riscaldamento e composti correlati(28 prodotti)
- Ormoni(356 prodotti)
- Biologia vegetale(6.910 prodotti)
- Metaboliti secondari(14.344 prodotti)
Trovati 130210 prodotti di "Prodotti biochimici e reagenti"
Biotin-Bradykinin
Catalogue peptide; min. 95% purity
Formula:C60H87N17O13SPeso molecolare:1,286.53 g/molRef: 3D-VAC-00108
Prodotto fuori produzioneα-Melanocyte Stimulating Hormone, acetylated-[D-Val13] (11-13) (MSHa)
Catalogue peptide; min. 95% purity
Formula:C18H33N5O4Peso molecolare:383.49 g/molRef: 3D-VAC-00035
Prodotto fuori produzioneSynaptobrevin-2 (75-78) (human, bovine, mouse, rat)
Catalogue peptide; min. 95% purity
Formula:C23H33N5O9Peso molecolare:523.55 g/molRef: 3D-VAC-00640
Prodotto fuori produzioneVasoactive Intestinal Contractor [VIC]
Catalogue peptide; min. 95% purity
Formula:C116H161N27O32S4Peso molecolare:2,573.99 g/molRef: 3D-VAC-00288
Prodotto fuori produzioneH-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH
Peptide H-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ref: 3D-PP47266
Prodotto fuori produzioneAtorvastatin sodium
CAS:HMG-CoA reductase antagonist
Formula:C33H35FN2O5•NaPurezza:Min. 95%Colore e forma:PowderPeso molecolare:581.63 g/molPergolide mesylate
CAS:Prodotto controllatoD1 and D2 dopamine agonist
Formula:C20H30N2O3S2Purezza:Min. 95%Colore e forma:White To Off-White SolidPeso molecolare:410.6 g/molFmoc-Phe-Wang resin (100-200 mesh)
Please enquire for more information about Fmoc-Phe-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purezza:Min. 95%Ref: 3D-FF111733
Prodotto fuori produzioneKetolide resistance Peptide MRFFV
Catalogue peptide; min. 95% purity
Formula:C34H50N8O6SPeso molecolare:698.9 g/molRef: 3D-VAC-00610
Prodotto fuori produzione[Ser25]-PKC (19-31)
Catalogue peptide; min. 95% purity
Formula:C67H118N26O17Peso molecolare:1,559.85 g/molRef: 3D-VAC-00659
Prodotto fuori produzioneSynaptobrevin-2 (73-79) (human, bovine, mouse, rat)
Catalogue peptide; min. 95% purity
Formula:C32H48N8O14Peso molecolare:768.78 g/molRef: 3D-VAC-00255
Prodotto fuori produzioneZ-Asp-Gln-Met-Asp-AFC
CAS:Please enquire for more information about Z-Asp-Gln-Met-Asp-AFC including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C36H39F3N6O13SPurezza:Min. 95%Peso molecolare:852.79 g/molRef: 3D-FA110597
Prodotto fuori produzioneNeurotrophic Factor for Retinal Cholinergic Neurons
Catalogue peptide; min. 95% purity
Formula:C53H84N12O16Peso molecolare:1,145.33 g/molRef: 3D-VAC-00891
Prodotto fuori produzioneLanabecestat
CAS:Lanabecestat is an investigational drug, classified as a beta-secretase (BACE) inhibitor, which is derived from synthetic chemical processes. Its mode of action involves inhibiting the enzyme beta-secretase, which plays a crucial role in the amyloidogenic pathway by cleaving amyloid precursor protein (APP) into amyloid-beta peptides. The accumulation of these peptides is a hallmark of Alzheimer's disease pathology.
Formula:C26H28N4OPurezza:Min. 95%Colore e forma:PowderPeso molecolare:412.53 g/molRef: 3D-IFC98264
Prodotto fuori produzioneICG 001
CAS:Inhibits interaction between CREB binding protein (CBP) and Wnt/β-catenin
Formula:C33H32N4O4Purezza:Min. 95%Peso molecolare:548.63 g/molKUNB31
CAS:KUNB31 is a synthetic enzyme inhibitor, which is an engineered compound designed to interfere with the activity of specific enzymes in various biochemical pathways. This product is synthesized through a series of complex chemical reactions, ensuring high specificity and activity against target enzymes. Its mode of action involves binding to the active sites of enzymes, thereby preventing substrates from interacting and altering enzymatic activity.
Formula:C19H18N2O3Purezza:Min. 95%Peso molecolare:322.4 g/molRef: 3D-VND26380
Prodotto fuori produzionegp120, HIV-1 MN
Catalogue peptide; min. 95% purity
Formula:C135H221N45O33Peso molecolare:3,002.55 g/molRef: 3D-VAC-00900
Prodotto fuori produzione[Gln11]-beta-Amyloid (1-28)
Catalogue peptide; min. 95% purity
Formula:C145H210N42O45Peso molecolare:3,261.54 g/molRef: 3D-VAC-00315
Prodotto fuori produzioneAmyloid beta-Protein (25-35) amide
Catalogue peptide; min. 95% purity
Formula:C45H82N14O13SPeso molecolare:1,059.31 g/molRef: 3D-VAC-00452
Prodotto fuori produzioneSubstance P reversed sequence
Catalogue peptide; min. 95% purity
Formula:C63H98N18O13SPeso molecolare:1,347.66 g/molRef: 3D-VAC-00604
Prodotto fuori produzione
![α-Melanocyte Stimulating Hormone, acetylated-[D-Val13] (11-13) (MSHa)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00035.webp&w=3840&q=75)
![Vasoactive Intestinal Contractor [VIC]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00288.webp&w=3840&q=75)
![[Ser25]-PKC (19-31)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00659.webp&w=3840&q=75)
![[Gln11]-beta-Amyloid (1-28)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00315.webp&w=3840&q=75)
