Prodotti biochimici e reagenti

<p>MTHFS antibody was raised using a synthetic peptide corresponding to a region with amino acids TSWNIPQPGEGDVREEALSTGGLDLIFMPGLGFDKHGNRLGRGKGYYDAY</p>

<p>ELISA kit for the detection of Cardiolipin screen IgG/IgM/IgA1 in the research laboratory</p>

<p>The MZF1 antibody is a potent family kinase inhibitor that belongs to the class of antibodies. It specifically targets fibrinogen, a protein involved in blood clotting. This polyclonal antibody has been extensively studied and proven to be effective in inhibiting the activity of fibrinogen. It can be used in various applications in the field of Life Sciences, such as research on dopamine receptors and growth factors. Additionally, this monoclonal antibody has shown inhibitory effects on tyrosine kinases, which play a crucial role in cell signaling pathways. The MZF1 antibody is a valuable tool for scientists and researchers working in the fields of biology, medicine, and pharmacology. Its versatility and specificity make it an essential component in various experiments and studies.</p>

<p>ELISA kit for the detection of CA 15-3 in the research laboratory</p>

<p>Human KLK2(Kallikrein-2) ELISA Kit</p>

<p>PNN antibody was raised using the N terminal of PNN corresponding to a region with amino acids MAVAVRTLQEQLEKAKESLKNVDENIRKLTGRDPNDVRPIQARLLALSGP</p>

<p>The NP antibody is a monoclonal antibody that specifically targets antiphospholipid antibodies. It is designed to recognize and bind to glycopeptides and glycoproteins associated with these autoantibodies. The NP antibody has cytotoxic properties and can be used for various applications in research and diagnostics.</p>

<p>Retosiban is a pharmaceutical compound that serves as an oxytocin receptor antagonist, derived through synthetic chemical synthesis. Its primary mechanism of action involves the selective inhibition of oxytocin receptors, which are critical in the uterine contractions that occur during labor. By blocking these receptors, Retosiban effectively reduces uterine muscle contractions, thus playing a crucial role in managing preterm labor.</p>

<p>HC-056456 is a small molecule that binds to the adenylyl cyclase and activates it. It has been shown to reversibly activate the enzyme in both an asymmetric and symmetric form, with a preference for the asymmetric form. HC-056456 has been shown to increase intracellular calcium levels by activating the adenylyl cyclase and can be used in experiments involving the study of atypical capacitation.</p>

<p>Mouse monoclonal UBOX5 antibody</p>

<p>ON-013100 is a protease inhibitor that inhibits the activity of the chymotrypsin-like proteases and trypsin family. It has been shown to inhibit cancer cell growth and induce apoptosis. ON-013100 also has immunomodulatory effects, which have been demonstrated by an increase in tumor necrosis factor receptor 1 (TNFR1) expression, as well as an increase in the release of proinflammatory cytokines such as interleukin 6 (IL-6) and tumor necrosis factor alpha (TNFα).</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LYVE1 antibody, catalog no. 70R-6181</p>

<p>OLFML2A antibody was raised using the N terminal of OLFML2A corresponding to a region with amino acids EDFYTVETVSSGTDCRCSCTAPPSSLNPCENEWKMEKLKKQAPELLKLQS</p>

<p>ELISA kit for detection of BAFF in the research laboratory</p>

<p>ETR3 antibody was raised in rabbit using C terminal sequence [VQLKRSKNDSKPYC] of human and mouse ETR-3 as the immunogen.</p>

<p>dCBP-1 is a potent inhibitor of the kinase activity that is found in tumor cells. It has been shown to induce apoptosis in cancer cells and inhibit the growth of tumors in animal models. dCBP-1 is an analog of a protein that is found in human urine and has medicinal potential as an anti-cancer agent. This compound has been tested on Chinese hamster ovary cell lines and has demonstrated significant inhibition of tumor cell growth. As a promising anticancer drug, dCBP-1 holds great potential for the development of novel cancer therapeutics.</p>

<p>ELISA Kit for detection of Estradiol in the research laboratory</p>

<p>Berkeleylactone E is a potent anticancer agent that works by inhibiting kinase activity and inducing apoptosis in cancer cells. This natural compound selectively targets cancer cells, leaving healthy cells unharmed. Berkeleylactone E has been shown to inhibit the activity of cyclin-dependent kinases, which are essential for cell cycle progression and tumor growth. By blocking these kinases, Berkeleylactone E halts the cell cycle and triggers apoptosis in cancer cells. This medicinal compound also inhibits the production of proteins that promote cancer cell survival, making it a promising candidate for cancer treatment. With its unique properties as an inhibitor of kinase activity and inducer of apoptosis, Berkeleylactone E represents a promising avenue for developing new cancer therapies.</p>

<p>Please enquire for more information about Human Alpha 1-Antichymotrypsin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Purified Polyclonal CTPS antibody</p>