Prodotti biochimici e reagenti
I biochimici e i reagenti sono sostanze fondamentali per la ricerca e lo sviluppo in campi come la biotecnologia, la biologia molecolare, la farmacologia e la medicina. Questi prodotti sono essenziali per una varietà di applicazioni, tra cui la sintesi di composti, l'analisi di campioni biologici, la ricerca sui processi metabolici e la produzione di farmaci. Presso CymitQuimica offriamo un'ampia selezione di biochimici e reagenti di alta qualità e purezza, adatti a diverse esigenze scientifiche e industriali. Il nostro catalogo include enzimi, anticorpi, acidi nucleici, amminoacidi e molti altri prodotti, tutti progettati per supportare i ricercatori e i professionisti nei loro progetti di ricerca e sviluppo, garantendo risultati affidabili e riproducibili.
Sottocategorie di "Prodotti biochimici e reagenti"
- Biomolecole(99.152 prodotti)
- Per obiettivo biologico(100.635 prodotti)
- Per uso/effetti farmacologici(6.815 prodotti)
- Composti relativi alla crioconservazione e crioconservanti(21 prodotti)
- Disinfettanti, additivi per fluidi per bagni di riscaldamento e composti correlati(28 prodotti)
- Ormoni(346 prodotti)
- Biologia vegetale(6.727 prodotti)
- Metaboliti secondari(14.353 prodotti)
Trovati 130615 prodotti di "Prodotti biochimici e reagenti"
Ordinare per
Purezza (%)
0
100
|
0
|
50
|
90
|
95
|
100
Hamster CHO Clusterin ELISA Kit
<p>Hamster (CHO) Clusterin ELISA Kit<br>Clusterin plays key roles in protein homeostasis/proteostasis, and the modulation of pro-survival signaling networks.</p>Purezza:Min. 95%Recombinant Human PDGF Ralpha
<p>Human sequence expressed in NS0 Cells; purity >97% by SDS-PAGE and analyzed by silver stain.</p>Bovine CRP ELISA Kit
<p>Bovine/Cow CRP ELISA Kit - For the quantitative determination of c-reactive protein (CRP) in cow/bovine samples.</p>Purezza:Min. 95%Mouse Fibrinogen ELISA Kit
<p>Please enquire for more information about Mouse Fibrinogen ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purezza:Min. 95%Dog SAA ELISA Kit
<p>Canine/Dog SAA ELISA Kit - For the quantitative determination of serum amyloid A (SAA) in dog samples.</p>Purezza:Min. 95%Recombinant Human Prolactin Receptor
<p>Human sequence expressed in NS0 Cells; purity >90% by SDS-PAGE and analyzed by silver stain; Fc Fusion Protein.</p>Chicken SAA ELISA Kit
<p>Chicken SAA ELISA Kit - For the quantitative determination of serum amyloid A (SAA) in chicken samples.</p>Purezza:Min. 95%Dog IgA ELISA Kit
<p>Please enquire for more information about Dog IgA ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purezza:Min. 95%Human IgE ELISA Kit
<p>Please enquire for more information about Human IgE ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purezza:Min. 95%Ref: 3D-CLA1061
Prodotto fuori produzione16:0-18:1 Diether pe
CAS:<p>16:0-18:1 Diether Peptide is a research tool that can be used to study protein interactions and receptor ligand relationships. It also inhibits ion channels, which are responsible for regulating the flow of ions across the cell membrane. 16:0-18:1 Diether Peptide has been shown to activate antibodies and is a high purity, chemically synthesized molecule with CAS No. 141456-20-4.</p>Formula:C39H80NO6PPurezza:Min. 95%Peso molecolare:690.03 g/molRef: 3D-RFA45620
Prodotto fuori produzioneANKRD54 antibody
<p>ANKRD54 antibody was raised using the middle region of ANKRD54 corresponding to a region with amino acids EVHALKRLRDSANANDVETVQQLLEDGADPCAADDKGRTALHFASCNGND</p>NOB1 antibody
<p>NOB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TEIRDKATRRRLAVLPYELRFKEPLPEYVRLVTEFSKKTGDYPSLSATDI</p>MAFK antibody
<p>MAFK antibody was raised in rabbit using the N terminal of MAFK as the immunogen</p>Purezza:Min. 95%CDK2AP2 protein (His tag)
<p>Purified recombinant Human CDK2AP2 protein (His tag)</p>Purezza:Min. 95%NF kappaB p65 antibody
<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug from the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its efficacy has been demonstrated through patch-clamp techniques on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis, oxidation, reduction, and conjugation. Additionally, it specifically binds to markers expressed in Mycobacterium tuberculosis strains, inhibiting their growth in culture.</p>
