Prodotti biochimici e reagenti

<p>SIRT7 antibody was raised in rabbit using the middle region of SIRT7 as the immunogen</p>

<p>Purified Polyclonal TFAP2C antibody</p>

<p>The Beta actin antibody is a highly effective neutralizing agent that targets telomerase, an enzyme involved in cell division and aging. This monoclonal antibody has been extensively tested and proven to have exceptional binding affinity towards telomerase, making it an essential tool for researchers in the field of Life Sciences.</p>

<p>Mouse monoclonal AK4 antibody</p>

<p>Leptin antibody was raised in mouse using highly pure recombinant human leptin as the immunogen.</p>

<p>Epsin 2 antibody was raised using the middle region of EPN2 corresponding to a region with amino acids SHSEQEYGKAGGSPASYHGSTSPRVSSELEQARPQTSGEEELQLQLALAM</p>

<p>GPR27 antibody was raised using the middle region of GPR27 corresponding to a region with amino acids AVTLLFLLLWGPYVVASYLRVLVRPGAVPQAYLTASVWLTFAQAGINPVV</p>

<p>Rabbit polyclonal NARFL antibody</p>

<p>Mouse monoclonal UHMK1 antibody</p>

<p>Bapx1 antibody was raised in rabbit using the N terminal of BAPX1 as the immunogen</p>

<p>GAPDH antibody was raised in mouse using recombinant GAPDH as the immunogen.</p>

<p>PDCD11 antibody was raised in mouse using recombinant Human Programmed Cell Death 11</p>

<p>HHEX antibody was raised in mouse using recombinant Homeobox, Hematopoietically Expressed</p>

<p>PDSS1 antibody was raised using a synthetic peptide corresponding to a region with amino acids VIDDASSRRGKHTVNKIWGEKKAVLAGDLILSAASIALARIGNTTVISIL</p>

<p>The PPARG antibody is a highly specialized polyclonal antibody used in the field of Life Sciences. It is designed to target and bind to PPARG, a protein involved in various cellular processes. This antibody has been extensively tested and validated using human serum samples, ensuring its reliability and accuracy.</p>

<p>The GPR1 antibody is a monoclonal antibody that specifically targets the epidermal growth factor receptor (EGFR). It belongs to the family of EGFR-like antibodies and has been shown to have neutralizing effects on the activity of EGFR. This antibody can be used in various research applications, including immunohistochemistry and Western blotting, to study the role of EGFR in cell signaling pathways. Additionally, the GPR1 antibody has been used to investigate the interactions between EGFR and other molecules, such as fibronectin and chemokines. Its high specificity and affinity make it a valuable tool for researchers in the field of life sciences studying growth factors and their associated signaling pathways.</p>

<p>The Theophylline antibody is a polyclonal antibody that targets the growth factor and multidrug resistance protein known as Theophylline. This glycopeptide is involved in various biological processes, including epidermal growth factor signaling, collagen synthesis, and glycosylation. The Theophylline antibody has been extensively tested and validated for its specificity and sensitivity in detecting Theophylline in various samples. It can be used in immunoassays such as ELISA or Western blotting to quantify the levels of Theophylline or to study its interactions with other proteins or receptors. Researchers have also used this antibody to investigate the role of Theophylline in erythropoietin activation and signaling through the erythropoietin receptor. Additionally, monoclonal antibodies against Theophylline have been developed for therapeutic applications, such as targeting interleukin-6 or helicobacter infections. With its high affinity and selectivity, the Theophylline antibody</p>

<p>CALML5 antibody was raised in Rabbit using Human CALML5 as the immunogen</p>

<p>Lactoferrin antibody was raised in Mouse using purified human lactoferrin as the immunogen.</p>

<p>SIGLEC12 antibody was raised using the N terminal of SIGLEC12 corresponding to a region with amino acids GRFLLLGDPQTNNCSLSIRDARKGDSGKYYFQVERGSRKWNYIYDKLSVH</p>

<p>Mouse monoclonal TBC1D21 antibody</p>

<p>Chicken RBC antibody (Texas Red) was raised in rabbit using chicken erythrocytes as the immunogen.</p>

<p>Purified Rabbit polyclonal MRLC2 antibody</p>

<p>Rabbit polyclonal RPL5 antibody</p>

<p>Rabbit polyclonal TP53I3 antibody</p>

<p>NSUN3 antibody was raised using the middle region of NSUN3 corresponding to a region with amino acids GGKSIALLQCACPGYLHCNEYDSLRLRWLRQTLESFIPQPLINVIKVSEL</p>

<p>The RAN antibody is a versatile tool used in life sciences research. It is an antibody that specifically targets the RAN protein, which plays a crucial role in various cellular processes such as signal transduction, nucleocytoplasmic transport, and cell cycle regulation. This antibody has been extensively characterized using mass spectrometric methods to ensure its specificity and reliability.</p>

<p>Rabbit polyclonal PNKD antibody</p>

<p>Purified recombinant WLS protein (His tag)</p>

<p>CD4 antibody (FITC) was raised in mouse using human CD4 as the immunoge.</p>

<p>Human serum albumin antibody (HRP) was raised in rabbit using human serum albumin as the immunogen.</p>

D-dimer antibody is a monoclonal antibody that specifically targets D-dimer, a protein fragment that is produced when blood clots are broken down. This antibody has antiviral properties and can neutralize the activity of D-dimer, preventing excessive blood clot formation. In addition to its therapeutic use, this antibody is also used in research and diagnostics in the field of Life Sciences. It can be used to study the role of D-dimer in various biological processes, such as wound healing and thrombosis. The formulation of this antibody includes excipients like histidine and insulin to ensure stability and enhance its efficacy.

<p>ATF3 antibody was raised in mouse using recombinant Human Activating Transcription Factor 3</p>

<p>The C9 antibody is a potent inhibitor that belongs to the group of monoclonal antibodies. It is commonly used in cytometry analysis and has been shown to be effective in neutralizing endothelial growth factors. This antibody is particularly useful in the field of Life Sciences, as it can be used for drug preparation and has antiviral properties. Additionally, the C9 antibody is a powerful inhibitor of choroidal neovascularization, making it a valuable tool in the treatment of various eye disorders. Its strong neutralizing activity against human serum proteins further enhances its effectiveness as an inhibitor.</p>

Rabbit polyclonal PACS2 antibody

<p>Recombinant human IL-1alpha</p>

<p>Mouse monoclonal PDHA1 antibody</p>

<p>The AFP antibody is a monoclonal antibody that targets the alpha-fetoprotein (AFP), a glycoprotein that is involved in various biological processes. This antibody specifically binds to AFP and can be used for diagnostic purposes, such as detecting the presence of AFP in blood samples. Additionally, the AFP antibody has shown potential therapeutic applications, particularly in the field of cancer treatment. It has been studied as an anti-HER2 antibody, inhibiting the growth factor receptor HER2 and potentially offering targeted therapy for HER2-positive cancers. The AFP antibody can also be used in research settings to study other proteins, such as alpha-synuclein or epidermal growth factor receptors. With its specificity and versatility, the AFP antibody holds promise in both diagnostics and therapeutics for various diseases and conditions.</p>

<p>Carbamazepine Conjugate for use in immunoassays</p>

<p>The Measles virus protein is a multifunctional protein that exhibits various characteristics. It has insulin-like properties and can interact with alpha-fetoprotein, a growth factor involved in fetal development. Monoclonal antibodies can be used to target this protein for research purposes. Additionally, it has natriuretic properties, meaning it affects the balance of sodium and water in the body. The Measles virus protein also plays a role in fatty acid metabolism and telomerase activity, which is important for maintaining the integrity of DNA. It has been found to localize in the nucleus and may have implications in nuclear processes. Furthermore, it interacts with brain natriuretic peptide and antibodies against this protein can be used as diagnostic tools. If you're looking for Native Proteins &amp; Antigens or acidic growth factor-1 receptor-related products, the Measles virus protein may be of interest to you. Explore our range of Proteins and Antigens to find products related to this</p>

<p>The SMARCA4 antibody is a monoclonal antibody used in the field of Life Sciences. It is a medicament that targets and binds to SMARCA4, a protein involved in various cellular processes such as DNA repair and gene regulation. The SMARCA4 antibody has been shown to be activated upon binding, leading to downstream effects such as the inhibition of phosphatase activity and the promotion of growth factor signaling. Additionally, this antibody has demonstrated its ability to interact with other proteins like fibrinogen, lipoprotein lipase, and collagen, suggesting its potential role in modulating cell-matrix interactions. With its specificity and versatility, the SMARCA4 antibody is an invaluable tool for researchers studying epidermal growth factors, histidine metabolism, and carbamazepine response pathways.</p>

<p>Rabbit polyclonal RAB41 antibody</p>

<p>The ACSS2 antibody is a highly specialized product in the field of Life Sciences. It belongs to the category of monoclonal antibodies and is specifically designed to target and inhibit the activity of the macrophage colony-stimulating factor (CSF). This antibody has been extensively tested and proven effective in various research studies.</p>

<p>The Moesin antibody is a highly specialized monoclonal antibody used in Life Sciences research. It plays a crucial role in studying growth factors, binding proteins, and various cellular processes. This antibody is widely used in electrode-based experiments to study the interaction between specific proteins and their targets. Additionally, it has been utilized to investigate the role of Moesin in androgen signaling pathways. The Moesin antibody is also employed in the detection of autoantibodies present in human serum samples. With its high specificity and sensitivity, this antibody is an essential tool for researchers working on protein analysis and understanding complex cellular mechanisms.</p>

<p>The EID3 antibody is a highly effective biomolecule used in the field of Life Sciences. This activated antibody specifically targets and binds to tumor necrosis factor-alpha (TNF-α), a key player in inflammatory responses. It is available in both monoclonal and polyclonal forms, ensuring versatility for various research applications.</p>

<p>The IgM antibody is a monoclonal antibody used in the field of Life Sciences. It is specifically designed to detect and bind to a recombinant antigen, making it an invaluable tool for research and diagnostic purposes. This antibody is colloidal in nature, allowing for easy detection and visualization of the target antigen.</p>

<p>KCNN3 antibody was raised using the C terminal of KCNN3 corresponding to a region with amino acids ITELNDRSEDLEKQIGSLESKLEHLTASFNSLPLLIADTLRQQQQQLLSA</p>

<p>LGALS8 antibody was raised using a synthetic peptide corresponding to a region with amino acids FPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEINGD</p>

<p>Rabbit polyclonal PLCG1 antibody</p>

<p>Mouse monoclonal Citrate Lyase antibody (C-terminus)</p>

<p>The Sumo1 antibody is a polyclonal antibody that is used for the immobilization of human serum on an electrode. It is commonly used in research and laboratory settings to study the binding proteins and inhibitors involved in various cellular processes. This antibody has also been shown to have neutralizing effects on interferon, making it a valuable tool in immunology research. Additionally, the Sumo1 antibody has demonstrated neuroprotective properties and has been investigated for its potential use in treating neurodegenerative disorders. However, it is important to note that this antibody may have teratogenic effects and should be handled with caution. In the field of Life Sciences, the Sumo1 antibody plays a crucial role in understanding cellular pathways and protein interactions.</p>

<p>Rabbit polyclonal PYGB antibody</p>

<p>Mouse monoclonal FAM40A antibody</p>

GSTA4 antibody was raised using the C terminal of GSTA4 corresponding to a region with amino acids LSAFPFLQEYTVKLSNIPTIKRFLEPGSKKKPPPDEIYVRTVYNIFRP

Chymotrypsin is a protease that hydrolyses proteins by cleaving the peptide bond at the carboxyl side of the aromatic amino acids (Phenylalanine, Tyrosine or Tryptophan). Chemotrypsin belongs to a family of serine proteases, as it has a serine in its active site.

<p>AATF antibody was raised in mouse using recombinant Apoptosis Antagonizing Transcription Factor</p>

<p>App antibody was raised in rabbit using the C terminal of App as the immunogen</p>

<p>Mouse monoclonal CDKN3 antibody</p>

<p>Purified Polyclonal HMGN1 antibody</p>

<p>Purified Polyclonal Basonuclin antibody</p>

<p>Alpha-1 trypsin antibody was raised in goat using human alpha-1-anti-trypsin as the immunogen.</p>

<p>Purified Rabbit polyclonal p70 S6 Kinase antibody (Ser371)</p>

<p>PCNP antibody was raised using the middle region of PCNP corresponding to a region with amino acids AKMRMKNIGRDTPTSAGPNSFNKGKHGFSDNQKLWERNIKSHLGNVHDQD</p>

<p>Guinea Pig Red Blood Cells (GPRBC) are widely used in veterinary applications and life sciences research. They serve as a growth factor for various experiments and studies. GPRBC can be stored in glycerin, ensuring their longevity and usability. These red blood cells have been utilized in research on choroidal neovascularization, hemolytic activities, receptor binding, and neutralizing monoclonal antibodies. GPRBC have also been studied for their role in the metabolism of cyp2a6 and racemase enzymes in human serum. With their diverse applications and significant contributions to scientific research, Guinea Pig Red Blood Cells are an essential resource for researchers in the field of life sciences.</p>

<p>Mouse monoclonal CALCA antibody</p>

<p>Mouse monoclonal RABL2A antibody</p>

<p>Rabbit polyclonal REG1B antibody</p>

CFI-400437 is a peptide that binds to the beta2 subunit of the nicotinic acetylcholine receptor. It has been shown to inhibit the activity of this receptor and is used as a research tool for studying the effects of nicotinic acetylcholine receptors on life science, pharmacology, and cell biology. CFI-400437 has also been shown to be a high purity inhibitor of ion channels.

<p>GMCSF antibody was raised in Rat using recombinant human GM-CSF as the immunogen.</p>

<p>Mouse monoclonal DPP9 antibody</p>

<p>The STMN1 antibody is a monoclonal antibody that targets the growth factor Stathmin 1 (STMN1). It has been extensively studied in the field of Life Sciences and has shown promising results in various applications.</p>

<p>Growth Hormone antibody was raised in mouse using recombinant human growth hormone (27-217aa) purified from E. coli as the immunogen.</p>

<p>Mouse monoclonal NPR3 antibody</p>

<p>Esrp2 antibody was raised in rabbit using the C terminal of Esrp2 as the immunogen</p>

<p>Hamster lymphocyte antibody (FITC) was raised in rabbit using RBC-free hamster thymus and spleen cells as the immunogen.</p>

<p>Mucolipin 3 antibody was raised using the middle region of MCOLN3 corresponding to a region with amino acids TVELQFKLKAINLQTVRHQELPDCYDFTLTITFDNKAHSGRIKISLDNDI</p>

<p>The Cytokeratin 8 antibody is a powerful tool in the field of Life Sciences. This antibody specifically targets and inhibits the growth of endothelial cells, which play a crucial role in angiogenesis and tumor development. By neutralizing the activity of endothelial growth factors, this antibody has shown promising results in inhibiting tumor growth and metastasis.</p>

<p>IFN beta antibody was raised in rabbit using rat interferon beta as the immunogen.</p>

<p>The CEA antibody is a highly specialized monoclonal antibody that targets carcinoembryonic antigen (CEA). It is widely used in the field of life sciences for various applications. This antibody specifically recognizes and binds to CEA, a glycosylated protein that is involved in cell adhesion and plays a role in insulin signaling.</p>

<p>Rabbit polyclonal RTKN2 antibody</p>

<p>Rabbit polyclonal ELMOD2 antibody</p>

<p>Rhodamine B hydrazide is a fluorescent chemical probe, which is synthetically derived from Rhodamine B, a xanthene dye. This compound functions primarily as a reactive oxygen species (ROS) detector, facilitated by its unique molecular structure that allows it to selectively respond to oxidative environments.</p>

<p>Rabbit polyclonal TRERF1 antibody</p>

<p>Rabbit polyclonal MYD1 antibody</p>

<p>Purified Rabbit polyclonal PKA antibody (Thr197)</p>

<p>The LLO antibody is a high-quality monoclonal antibody that is widely used in the field of Life Sciences. It has been specifically designed to target and neutralize superoxide, a highly reactive oxygen species that can cause damage to cells and tissues. This antibody has a high specific activity and exhibits low density, making it an ideal choice for various applications such as enzyme-linked immunosorbent assays (ELISA), Western blotting, and immunohistochemistry.</p>

<p>The HIP1 antibody is a highly specialized reagent used in life sciences research. It is a polyclonal antibody that specifically targets hematopoietic and gastrointestinal stromal proteins. This antibody has the ability to bind to DNA double-strand breaks, making it an invaluable tool for studying DNA repair mechanisms. The HIP1 antibody can be used in various applications, including immunohistochemical staining and protein interaction studies. Researchers can use this antibody as a test compound to evaluate the efficacy of potential inhibitors or affinity ligands. With its high specificity and versatility, the HIP1 antibody is an essential tool for scientists working in the field of molecular biology and genetics.</p>

Hemoglobin antibody was raised in mouse using human hemoglobin as the immunogen.

<p>Purified Rabbit polyclonal OR1B1 antibody</p>

<p>MLSTD1 antibody was raised using the C terminal Of Mlstd1 corresponding to a region with amino acids WSTYNTEMLMSELSPEDQRVFNFDVRQLNWLEYIENYVLGVKKYLLKEDM</p>

<p>CHN2 antibody was raised using a synthetic peptide corresponding to a region with amino acids NHFNYEKTHNFKVHTFRGPHWCEYCANFMWGLIAQGVRCSDCGLNVHKQC</p>

<p>Proteasome 20S antibody was raised in rabbit using a Mixture of synthetic peptides corresponding to residues C R(207) V I L G N/D E L P K F Y D E(220) of human and mouse proteasome 20S LMP2 as the immunogen.</p>

<p>SLC25A28 antibody was raised using the middle region of SLC25A28 corresponding to a region with amino acids VWQNEGAGAFYRSYTTQLTMNVPFQAIHFMTYEFLQEHFNPQRRYNPSSH</p>

<p>Rabbit polyclonal Ring1A antibody</p>

Rabbit polyclonal RECQL5 antibody

<p>TRMT5 antibody was raised using a synthetic peptide corresponding to a region with amino acids EMLCITFQIPASVLYKNQTRNPENHEDPPLKRQRTAEAFSDEKTQIVSNT</p>

<p>Akt, also known as Protein Kinase B (PKB), is an essential cellular protein that governs vital processes such as cell growth, survival, metabolism, and proliferation through the PI3K/Akt pathway, which is activated by hormones like insulin. Upon activation, Akt translocates to the cell membrane, where it undergoes full activation via phosphorylation by kinases like PDK1. This activation allows Akt to prevent apoptosis, promote cell growth via pathways like mTOR, and boost glucose metabolism, crucial for insulin responsiveness. Dysregulation in the Akt pathway is frequently associated with diseases like cancer and diabetes; mutations in pathway components such as PI3K, PTEN, or Akt itself can result in enhanced cell survival, uncontrolled growth, and resistance to treatment in cancer, as well as impaired glucose uptake in diabetes. Given its central role in these processes, Akt is a primary target in therapeutic research focused on regulating growth and metabolism.</p>

<p>Mouse monoclonal PYCR2 antibody</p>

<p>Purified Polyclonal NT5C1B antibody</p>

<p>Rat monoclonal CD16/32 antibody (allophycocyanin)</p>