Prodotti biochimici e reagenti

<p>Cyclobenzaprine-D3 hydrochloride is a synthetic tricyclic compound that has been used as a research tool in the field of pharmacology and cell biology. Cyclobenzaprine-D3 hydrochloride is a potent ligand for the alpha-2A receptor, but it also inhibits the binding of serotonin to its receptors. Cyclobenzaprine-D3 hydrochloride binds to the receptor and can be used as an activator or inhibitor, depending on the type of experiment being run. Cyclobenzaprine-D3 hydrochloride is a high purity reagent.</p>

<p>Mouse monoclonal anti human C1QBP antibody</p>

<p>Rabbit polyclonal HMG14 antibody</p>

<p>The Caspase 6 antibody is a highly effective monoclonal antibody used in Life Sciences. This glycoprotein antibody specifically targets caspase 6, an enzyme involved in programmed cell death. By binding to caspase 6, this antibody inhibits its activity and prevents the initiation of apoptosis.</p>

<p>The RPA1 antibody is a monoclonal antibody that targets fatty acids and has antiviral properties. It specifically binds to cellulose and lipoprotein lipase, inhibiting their activity. This antibody also interacts with interferons, playing a role in immune response modulation. In the field of Life Sciences, RPA1 antibody is widely used for its neutralizing effects on various growth factors. Additionally, it has been found to have potential therapeutic applications in the treatment of autoimmune diseases due to its ability to target autoantibodies. With its acid modifications, this antibody offers enhanced stability and efficacy in research and diagnostic applications.</p>

<p>ZNF252 antibody was raised in rabbit using the middle region of ZNF252 as the immunogen</p>

<p>Mouse monoclonal N-acetyltransferase antibody</p>

<p>DLL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GSRCALALAVLSALLCQVWSSGVFELKLQEFVNKKGLLGNRNCCRGGAGP</p>

<p>Mouse monoclonal MSS1 antibody</p>

<p>HSV1 enriched cell lysate</p>

<p>Rabbit polyclonal SNX7 antibody</p>

<p>Mouse monoclonal SCHIP1 antibody</p>

<p>The Androgen Receptor Antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. This antibody specifically targets and binds to the androgen receptor, a protein that plays a crucial role in cell growth and development. By binding to the androgen receptor, this antibody inhibits its activation, thereby preventing the downstream signaling pathways involved in cell proliferation.</p>

<p>Rabbit polyclonal RBX1 antibody</p>

<p>TMEM91 antibody was raised using the N terminal of TMEM91 corresponding to a region with amino acids MDSPSLRELQQPLLEGTECETPAQKPGRHELGSPLREIAFAESLRGLQFL</p>

<p>GPR81 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Biotin is a coenzyme that is used to attach other molecules, such as proteins, to other molecules. Biotinylated fatty acids are used in the production of biotin-binding peptides and cell surface receptors for protein-protein interactions. Biotinylated fatty acids are also used as research tools in pharmacology and cell biology.</p>

<p>The CD42b antibody is a highly specific monoclonal antibody that targets nuclear β-catenin. It is widely used in Life Sciences research for its neutralizing properties and ability to detect and quantify β-catenin levels. This antibody can be used in various applications, including flow cytometry, immunohistochemistry, and Western blotting.</p>

<p>Purified recombinant TOMM34 protein (His tag)</p>

<p>The PD1 antibody is a monoclonal antibody that has been developed as a pneumococcal vaccine. It works by targeting and binding to the PD1 receptor on immune cells, which helps to enhance the body's immune response against pneumococcal infections. In addition to its role in immunity, the PD1 antibody also has other potential applications in the field of life sciences.</p>

<p>Rabbit polyclonal Androgen Receptor antibody (Ser213)</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the rifamycin class. It is specifically designed to combat tuberculosis infections by targeting active compounds and exhibiting potent bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Its efficacy has been extensively studied using advanced techniques like the patch-clamp technique on human erythrocytes. Additionally, it undergoes various metabolic transformations including hydrolysis, oxidation, reduction, and conjugation with glucuronic acid. Furthermore, this medication selectively binds to markers expressed in Mycobacterium tuberculosis strains and effectively inhibits their growth in culture.</p>

<p>COLEC12 antibody was raised in rabbit using the middle region of COLEC12 as the immunogen</p>

<p>SLC33A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids CNSVGQTAGYFLGNVLFLALESADFCNKYLRFQPQPRGIVTLSDFLFFWG</p>

<p>Thyroglobulin antibody is a specific antibody that is used in the field of Life Sciences. It is an activated monoclonal antibody that targets nuclear antigens. Thyroglobulin antibody has been extensively studied for its role in autoimmune diseases and has shown to be effective in neutralizing autoantibodies. Additionally, this antibody has been found to interact with chemokines, fibronectin, collagen, and TNF-α. Its high specificity and neutralizing properties make it a valuable tool for research purposes in the field of immunology and molecular biology.</p>

<p>DPY19L4 antibody was raised using a synthetic peptide corresponding to a region with amino acids APVAAVFAGSPQLMGAIKLCTGWMVTSLPLYNDDDLLKRNENIYQIYSKR</p>

<p>IRF5 antibody was raised in mouse using recombinant human IRF-5 (176-240aa) purified from E. coli as the immunogen.</p>

<p>The TRIB2 antibody is a monoclonal antibody that specifically targets the EBNA1 protein. This antibody is widely used in Life Sciences research to study various cellular processes. It has been shown to inhibit glycation, which is the non-enzymatic reaction between proteins and sugars that can lead to the formation of advanced glycation end products (AGEs). The TRIB2 antibody also plays a crucial role in cholinergic signaling by binding to plasmids and promoting the expression of choline acetyltransferase, an enzyme responsible for synthesizing the neurotransmitter acetylcholine. Additionally, this antibody has been found to modulate glycosylation patterns by interacting with glycopeptides and regulating the activity of phosphatases involved in signal transduction pathways. Its ability to modulate interferon production makes it a valuable tool in immunology research. Overall, the TRIB2 antibody offers researchers a powerful tool for studying autoantibodies and their role in various diseases and biological processes</p>

<p>TMTC2 antibody was raised using the N terminal of TMTC2 corresponding to a region with amino acids SNSDNPAADSDSLLTRTLTFFYLPTKNLWLLLCPDTLSFDWSMDAVPLLK</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CEP55 antibody, catalog no. 70R-2147</p>

<p>CYP4F12 antibody was raised using the middle region of CYP4F12 corresponding to a region with amino acids DGRRFHRACRLVHDFTDAVIRERRRTLPTQGIDDFFKDKAKSKTLDFIDV</p>

<p>The ICAM2 antibody is a powerful tool in the field of Life Sciences. It specifically targets and inhibits the rho-associated protein kinase, which plays a crucial role in various cellular processes. This antibody can be used for a wide range of applications, including nucleic acid conjugates, protein kinase inhibitors, and as a cdk2 inhibitor. Additionally, it has been extensively used in research as a diagnostic agent for genotoxicity studies.</p>

<p>Purified Rabbit polyclonal ENDOGL1 antibody</p>

<p>CGS 15435 is a synthetic compound that functions as a dopamine receptor agonist, derived from chemical synthesis processes involving targeted modifications of organic compounds. It exhibits high affinity and selectivity toward specific subtypes of dopamine receptors, which are G-protein-coupled receptors critical to neurotransmission in the central nervous system.</p>

<p>Rabbit polyclonal PTPIP51 antibody</p>

<p>The ASK1 antibody is a highly specialized monoclonal antibody that targets the activated form of the apoptosis signal-regulating kinase 1 (ASK1) enzyme. This antibody is commonly used in research laboratories and the pharmaceutical industry for various applications in the field of life sciences.</p>

<p>Purified Rabbit polyclonal ETK antibody (Tyr40)</p>

<p>Rabbit polyclonal GPR146 antibody</p>

<p>TSKS antibody was raised using the N terminal of TSKS corresponding to a region with amino acids MASVVVKTIWQSKEIHEAGDTPTGVESCSQLVPEAPRRVTSRAKGIPKKK</p>

<p>Rabbit polyclonal PO5F1 antibody</p>

<p>Purified Polyclonal CARD14 antibody</p>

<p>TM9SF4 antibody was raised using the N terminal of TM9SF4 corresponding to a region with amino acids HQNDPVEIKAVKLTSSRTQLPYEYYSLPFCQPSKITYKAENLGEVLRGDR</p>

<p>Mouse monoclonal CCM2 antibody</p>

<p>Purified recombinant CA11 protein (His tag)</p>

<p>KLRC3 antibody was raised using the N terminal of KLRC3 corresponding to a region with amino acids MSKQRGTFSEVSLAQDPKWQQRKPKGNKSSISGTEQEIFQVELNLQNASL</p>

<p>Rabbit polyclonal USP9X antibody</p>

<p>The Cyclin B1 antibody is a highly specialized polyclonal antibody that is used in the field of Life Sciences. It is specifically designed to target and bind to the Cyclin B1 protein, which plays a crucial role in cell division and proliferation. This antibody is available in both monoclonal and polyclonal forms, providing researchers with options to suit their specific needs.</p>

<p>Purified Polyclonal KLF17 antibody</p>

<p>UBE2E2 antibody was raised using a synthetic peptide corresponding to a region with amino acids GDQRESVQQEPEREQVQPKKKEGKISSKTAAKLSTSAKRIQKELAEITLD</p>

<p>NGAL protein is a multifunctional protein that plays a crucial role in various biological processes. It acts as an epidermal growth factor and has anti-mesothelin properties, making it valuable in the field of Life Sciences. NGAL protein functions as a growth factor and chemokine, promoting cell proliferation and migration. It can be used as a recombinant protein or antigen for research purposes.</p>

<p>The RAP1B antibody is an acidic growth factor that plays a crucial role in various biological processes. It is commonly used in Life Sciences research to study the functions of RAP1B, a small GTPase protein. This polyclonal antibody is highly specific and binds to RAP1B with high affinity, making it an excellent tool for detecting and quantifying RAP1B levels in different samples.</p>

<p>The Cyclin D1 antibody is a powerful tool in the field of Life Sciences. This antibody specifically targets and binds to Cyclin D1, an important protein involved in cell cycle regulation. It is available as both monoclonal and polyclonal antibodies, offering researchers a variety of options for their experiments.</p>

<p>Recombinant Human NUBP2 protein</p>

<p>The TCP1 antibody is a powerful tool used in various research fields, particularly in the life sciences. This antibody is known for its inhibitory properties against natriuretic peptides and activated protein kinases. It also acts as a neutralizing agent against chemokines, making it an essential component in immunoassays.</p>

<p>Human IgE antibody was raised in mouse using human myeloma IgE as the immunogen.</p>

<p>CLN8 antibody was raised using a synthetic peptide corresponding to a region with amino acids VFGVQSTAAGLWALLGDPVLHADKARGQQNWCWFHITTATGFFCFENVAV</p>

<p>The CD130 antibody is a polyclonal antibody that is widely used in the field of Life Sciences. It specifically targets the tyrosine kinase receptor CD130, which plays a crucial role in various cellular processes. This antibody can be used for research purposes to study the function and regulation of CD130.</p>

<p>Etomidate hydrochloride is a potent sedative and hypnotic agent that belongs to the class of imidazole derivatives. It is a fast-acting drug with an onset of action in 5 minutes and peak activity at 15 minutes. Etomidate hydrochloride has been extensively used as a general anesthetic for induction of anesthesia, and is effective in inducing rapid recovery from anesthesia. Etomidate hydrochloride has also been studied as a treatment for status epilepticus.</p>

<p>Lenperone hydrochloride is a peptide of the amino acid sequence Ac-D-Ala-Nle-Nle-Phe-Gly-D-Arg. It is an activator of ion channels and has been used as a research tool to study protein interactions. Lenperone hydrochloride interacts with receptors, ligands, and other proteins in cells. It can be used to investigate the role of ion channels in cell signaling and to understand how protein interactions are involved in the development of diseases such as cancer.</p>

<p>Iptacopan hydrochloride is a potent and selective inhibitor of the ion channel TRPM8. It binds to the ligand-binding site of TRPM8, blocking access to the channel. Iptacopan hydrochloride has been shown to inhibit the proliferation of human prostate cancer cells in cell culture studies.</p>

<p>FABP4 antibody was raised in mouse using recombinant human FABP4 (1-132aa) purified from E. coli as the immunogen.</p>

<p>Purified Rabbit polyclonal OR5K3 antibody</p>

<p>Rabbit polyclonal ZNF592 antibody (biotin)</p>

<p>The TRAIL antibody is a monoclonal antibody that has potent antitumor activity. It works by binding to the tumor necrosis factor-related apoptosis-inducing ligand (TRAIL) receptor, which induces apoptosis in cancer cells. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in inhibiting tumor growth and metastasis. Additionally, the TRAIL antibody has been found to be effective in treating ischemia-reperfusion injury and hepatic steatosis. It also exhibits cell lysis activity by targeting CD19-positive cells. The TRAIL antibody can be used as a valuable tool for research purposes or as a potential therapeutic agent for various diseases.</p>

<p>Rabbit Polyclonal APPL2 antibody</p>

<p>Purified recombinant Human CSTF1 protein (His tag)</p>

<p>The F9 antibody is a highly specific monoclonal antibody that targets erythropoietin. It is commonly used in various assays and research studies to detect and quantify the presence of erythropoietin in biological samples. This antibody recognizes a specific antigen on erythropoietin and can be used for various applications, including ELISA, Western blotting, immunohistochemistry, and flow cytometry.</p>

<p>35-107 amino acids: MGSSHHHHHH SSGLVPRGSH MASVATELRC QCLQTLQGIH PKNIQSVNVK SPGPHCAQTE VIATLKNGRK ACLNPASPIV KKIIEKMLNS DKSN</p>

<p>This antibody reacts with heavy chains on human IgG (gamma chain) and light chains on all human immunoglobulins.</p>

<p>ZNF417 antibody was raised in rabbit using the N terminal of ZNF417 as the immunogen</p>

<p>Zfp472 antibody was raised in rabbit using the N terminal of Zfp472 as the immunogen</p>

<p>Onecut 1 antibody was raised in rabbit using the C terminal of Onecut 1 as the immunogen</p>

<p>The ZNF410 antibody is a specific antibody used in Life Sciences research. It plays a crucial role as a heparin cofactor and is commonly used in various applications, including the detection of adeno-associated antibodies and autoantibodies. This antibody is also known for its ability to act as a zinc chelator and inhibitor of aminoacyl-tRNA synthetases. In addition, it has been found to modulate the release of neurotransmitters such as dopamine and serotonin. The ZNF410 antibody can serve as a valuable tool for studying the function of this antigen and may also have potential as a serum marker for certain diseases.</p>

<p>Rabbit polyclonal PKC pan antibody (Thr497)</p>

<p>Purified recombinant RBP2 protein (His tag)</p>

<p>Purified recombinant GNG4 protein (His tag)</p>

<p>CYC1 antibody was raised using the middle region of CYC1 corresponding to a region with amino acids RWASEPEHDHRKRMGLKMLMMMALLVPLVYTIKRHKWSVLKSRKLAYRPP</p>

<p>Insulin antibody is a highly specialized product used in Life Sciences research. It is an activated polyclonal antibody that specifically targets insulin. This antibody is widely used in immunohistochemistry studies to detect and visualize insulin expression in tissues. It has also been shown to have neutralizing activity against insulin, making it a valuable tool for studying the role of insulin in various biological processes.</p>

<p>NOL5A antibody was raised using a synthetic peptide corresponding to a region with amino acids YGYHFPELVKIINDNATYCRLAQFIGNRRELNEDKLEKLEELTMDGAKAK</p>

<p>Mouse monoclonal CD258 antibody (PE)</p>

<p>CKLF antibody was raised using the N terminal of CKLF corresponding to a region with amino acids MDNVQPKIKHRPFCFSVKGHVKMLRLALTVTSMTFFIIAQAPEPYIVITG</p>

<p>18-418 amino acids: MRGSHHHHHH GMASMTGGQQ MGRDLYDDDD KDRWGSHMAA EVKKPAAAAA PGTAEKLSPK AATLAERSAG LAFSLYQAMA KDQAVENILV SPVVVASSLG LVSLGGKATT ASQAKAVLSA EQLRDEEVHA GLGELLRSLS NSTARNVTWK LGSRLYGPSS VSFADDFVRS SKQHYNCEHS KINFRDKRSA LQSINEWAAQ TTDGKLPEVT KDVERTDGAL LVNAMFFKPH WDEKFHHKMV DNRGFMVTRS YTVGVMMMHR TGLYNYYDDE KEKLQIVEMP LAHKLSSLII LMPHHVEPLE RLEKLLTKEQ LKIWMGKMQK KAVAISLPKG VVEVTHDLQK HLAGLGLTEA IDKNKADLSR MSGKKDLYLA SVFHATAFEL DTDGNPFDQD IYGREELRSP KLFYADHPFI FLVRDTQSGS LLFIGRLVRP KGDKMRDEL</p>

<p>ZNF440 antibody was raised in rabbit using the C terminal of ZNF440 as the immunogen</p>

<p>Mouse monoclonal TTC32 antibody</p>

<p>NOMO1 antibody was raised using the N terminal of NOMO1 corresponding to a region with amino acids DGSFRLENITTGTYTIHAQKEHLYFETVTIKIAPNTPQLADIIATGFSVC</p>

<p>The ITPR1 antibody is a highly reactive polyclonal antibody that specifically targets the protein kinase inhibitors involved in human folate metabolism. This antibody is capable of neutralizing interferon-gamma and growth factor signaling pathways, making it an essential tool in life sciences research. Whether you're studying cell signaling or investigating immune responses, the ITPR1 antibody provides valuable insights into activated 3-kinase pathways. With its high specificity and reliable performance, this monoclonal antibody is a must-have for any researcher looking to advance their understanding of protein kinase regulation.</p>

<p>Troponin T antibody (cardiac) was raised in mouse using free human cTnT as the immunogen.</p>

<p>The FAM84B antibody is a highly specialized monoclonal antibody that targets the FAM84B protein. This protein plays a crucial role in various biological processes, including cell growth and proliferation. The FAM84B antibody has been extensively studied and shown to have potent inhibitory effects on the activity of FAM84B.</p>

<p>Trichomonas vaginalis antibody was raised in mouse using Trichomonas vaginalis as the immunogen.</p>

<p>Delangin B antibody was raised in Rat using Delangin peptide coupled carrier protein as the immunogen.</p>

<p>Mouse monoclonal EXD1 antibody</p>

<p>1-270 amino acids: MRGSHHHHHH GMASMTGGQQ MGRDLYDDDD KDRWGSHMLS AHWEKKKTSL VELQEQLQQL PALIADLESM TANLTHLEAS FEEVENNLLH LEDLCGQCEL ERCKHMQSQQ LENYKKNKRK ELETFKAELD AEHAQKVLEM EHTQQMKLKE RQKFFEEAFQ QDMEQYLSTG YLQIAERREP IGSMSSMEVN VDMLEQMDLM DISDQEALDV FLNSGGEENT VLSPALGPES STCQNEITLQ VPNPSELRAK PPSSSSTCTD SATRDISEGG ESPVVQSDEE EVQVDTALAT SHTDREATPD GGEDSDS</p>

<p>Zeranol Conjugate for use in immunoassays</p>

<p>LAMA4 antibody was raised in Rabbit using Human LAMA4 as the immunogen</p>

<p>Purified recombinant Lin28B protein (His tag)</p>

<p>Hantavirus (Seoul) antibody was raised in mouse using Nucleocapsid protein of Hantavirus R22 strain as the immunogen.</p>

<p>BTG1 antibody was raised in mouse using recombinant Human B-Cell Translocation Gene 1, Anti-Proliferative (Btg1)</p>

<p>Rabbit polyclonal XRCC6 antibody</p>

<p>Mouse monoclonal NUDT6 antibody</p>

<p>CMV antibody was raised in mouse using glycoprotein gH as the immunogen.</p>