Prodotti biochimici e reagenti

<p>THC antibody was raised in mouse using Tetrahydrocannabinol (THC)-BSA as the immunogen.</p>

<p>Rabbit polyclonal Transaldolase antibody (FITC)</p>

<p>TRIM56 antibody was raised in rabbit using the middle region of TRIM56 as the immunogen</p>

<p>Mouse monoclonal ITM2B antibody</p>

<p>CDK5RAP1 antibody was raised using the N terminal of CDK5RAP1 corresponding to a region with amino acids MMDELLGRQRKVYLETYGCQMNVNDTEIAWSILQKSGYLRTSNLQEADVI</p>

<p>Mouse monoclonal FOLH1 antibody</p>

<p>GJA1 antibody was raised using the N terminal of GJA1 corresponding to a region with amino acids LYLAHVFYVMRKEEKLNKKEEELKVAQTDGVNVDMHLKQIEIKKFKYGIE</p>

<p>The Doublecortin antibody is a monoclonal antibody that targets the protein doublecortin, which is involved in the development of nerve cells. This antibody has been widely used in neuroscience research to study neurogenesis and neuronal migration. It has also been used to detect doublecortin expression in various tissues, including brain tissue and tumor samples. The Doublecortin antibody is available in both monoclonal and polyclonal forms, allowing researchers to choose the best option for their specific experiments. With its high specificity and sensitivity, this antibody is an essential tool for investigating the role of doublecortin in various biological processes.</p>

<p>The VDAC2 antibody is a highly specific monoclonal antibody that targets the voltage-dependent anion channel 2 (VDAC2). This antibody is widely used in the field of life sciences for various applications. It has been shown to be effective in detecting and quantifying VDAC2 protein levels in different samples, including cell lysates and tissues.</p>

<p>Calsyntenin 1 antibody was raised using the N terminal of CLSTN1 corresponding to a region with amino acids KPWLEPTYHGIVTENDNTVLLDPPLIALDKDAPLRFAESFEVTVTKEGEI</p>

<p>The CENPH antibody is an acidic monoclonal antibody that specifically targets glial fibrillary acidic protein (GFAP). It is widely used in life sciences research to study the role of GFAP in various cellular processes. This antibody can be used for immunohistochemistry, immunofluorescence, and western blotting applications. It has high specificity and sensitivity, making it a valuable tool for studying the expression and localization of GFAP in different tissues and cell types. The CENPH antibody can also be used in studies related to insulin signaling, transferrin uptake, glucose-6-phosphate metabolism, collagen synthesis, and antiphospholipid antibodies. With its reliable performance and wide range of applications, this antibody is a must-have for researchers in the field of life sciences.</p>

<p>NKp46 antibody was raised in mouse using recombinant human Nkp46 (22-255aa) purified from E. coli as the immunogen.</p>

<p>Rabbit polyclonal SLC1A1 antibody</p>

<p>Rabbit polyclonal OR10J6 antibody</p>

<p>Chicken Red Blood Cells are widely used in the field of Life Sciences for various applications. They are commonly utilized in veterinary settings as an immune modulator and antimicrobial peptide. Chicken Red Blood Cells also serve as a diagnostic reagent, particularly in the detection of antibodies through techniques such as monoclonal antibody production and antibody-secreting cell assays. To obtain Chicken Red Blood Cells, sodium dodecyl sulfate or nonionic detergents can be used to induce cell lysis. Additionally, hydrochloric acid can be employed to further facilitate the lysis process. The resulting lysate can then be utilized for various downstream applications, including polymerase chain reactions (PCR) and other molecular biology techniques. Overall, Chicken Red Blood Cells offer a valuable resource for researchers and veterinarians alike, providing essential tools for immunological studies and diagnostic purposes. Their versatility and reliability make them an indispensable component in many scientific endeavors.</p>

<p>Cytokeratin 14 antibody was raised in guinea pig using recombinant human cytokeratin 14 as the immunogen.</p>

<p>Purified Polyclonal Kappa actin antibody</p>

<p>Myotrophin antibody was raised using the middle region of MTPN corresponding to a region with amino acids GRKPLHYAADCGQLEILEFLLLKGADINAPDKHHITPLLSAVYEGHVSCV</p>

<p>Mouse monoclonal anti human PDCL3 antibody</p>

<p>The IKB alpha antibody is a receptor-binding monoclonal antibody that targets the IKB alpha protein. It is commonly used in research and diagnostic applications to detect and quantify the levels of IKB alpha in various samples. The IKB alpha protein plays a crucial role in regulating the activity of NF-kappaB, a transcription factor involved in immune response and inflammation. By specifically binding to IKB alpha, this antibody can help researchers study the mechanisms underlying NF-kappaB activation and its downstream effects. Additionally, the IKB alpha antibody can be used as a tool for therapeutic purposes, such as blocking the interaction between IKB alpha and other binding proteins or autoantibodies. Its versatility makes it an essential tool for studying various biological processes and developing potential inhibitors for diseases associated with NF-kappaB dysregulation, such as autoimmune disorders or certain types of cancer.</p>

<p>Rat monoclonal Galectin 3 antibody (PE)</p>

<p>SCGB2A2 antibody was raised in Mouse using a purified recombinant fragment of human SCGB2A2 expressed in E. coli as the immunogen.</p>

<p>Rabbit polyclonal PKC mu antibody</p>

<p>ZNF136 antibody was raised in mouse using recombinant Zinc Finger Protein 136</p>

<p>TMB Substrate is a versatile product widely used in Life Sciences research. It is commonly utilized in various applications such as immunoassays and ELISA (enzyme-linked immunosorbent assay). TMB Substrate contains cefotiam, streptavidin, and monoclonal antibodies that enable accurate detection of specific targets. The substrate is activated by sodium carbonate and can be easily visualized with the addition of anhydrous sodium and hydrochloric acid. TMB Substrate also includes diluents, blockers, and assay reagents to optimize performance. It is compatible with human serum samples and can be used to measure chemokine levels or assess the activity of antibiotics like ceftriaxone and cefmetazole. Trust TMB Substrate for reliable and precise results in your scientific experiments.</p>

<p>TJAP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PGTSHTEGRAWPLPSSSRPQRSPKRMGVHHLHRKDSLTQAQEQGNLLN</p>

<p>Purified Polyclonal TAC1 antibody</p>

<p>Mouse monoclonal CTAG1B antibody</p>

<p>The RB1 antibody is a hydrophilic polyclonal antibody that specifically targets the retinoblastoma protein (RB1). This antibody is widely used in life sciences research to study the methylation of RB1 and its role in various cellular processes. RB1 is a tumor suppressor protein that regulates cell cycle progression and inhibits cell growth. Methylation of RB1 can affect its function, leading to abnormal cell proliferation and the development of diseases such as retinoblastoma and hepatocellular carcinoma. The RB1 antibody allows researchers to detect and analyze the methylation status of RB1, providing valuable insights into its role in disease development and potential therapeutic interventions. With its high specificity and sensitivity, this antibody is an essential tool for studying methyltransferase activity and understanding the molecular mechanisms underlying various biological processes.</p>

<p>Purified recombinant CXCL16 protein (Mouse) (His tag)</p>

<p>Purified native Human TBG protein</p>

<p>The EPN3 antibody is a highly potent and cytotoxic recombinant antigen that belongs to the class of antibodies used in Life Sciences. Specifically, it targets insulin and its related growth factors. This antibody has been extensively studied and shown to have neutralizing effects on insulin activity. It binds to specific epitopes on insulin molecules, preventing their interaction with receptors and inhibiting downstream signaling pathways.</p>

<p>SEMA6A antibody was raised using the middle region of SEMA6A corresponding to a region with amino acids ERVPKPRPGCCAGSSSLERYATSNEFPDDTLNFIKTHPLMDEAVPSIFNR</p>

<p>Rabbit polyclonal RapGEF1 antibody (Tyr504)</p>

<p>Rabbit polyclonal SNAPIN antibody</p>

<p>The p47 phox antibody is a polyclonal antibody that is used in Life Sciences research. It specifically targets the p47 phox protein, which plays a crucial role in the activation of macrophages. This antibody can be used to study the function and regulation of p47 phox in various biological processes.</p>

<p>The LILRB4 antibody is a monoclonal antibody that specifically targets the LILRB4 protein. This protein is known to play a role in immune regulation and has been found to be involved in various diseases, including cancer and autoimmune disorders. The LILRB4 antibody works by neutralizing the activity of the LILRB4 protein, thereby modulating immune responses.</p>

<p>Purified recombinant TNFRSF11A protein (His tag)</p>

<p>Recombinant Mouse IL33 protein</p>

<p>The TGFBR2 antibody is a polyclonal antibody that specifically targets the growth factor receptor known as TGFBR2. This antibody has been extensively studied and has shown promising results in various applications. It has been used in combination with other antibodies, such as trastuzumab, to enhance the cytotoxic effects against cancer cells. Additionally, the TGFBR2 antibody has been used to detect and quantify specific antibodies, including anti-ACTH antibodies, in various samples. It has also been utilized in research studies involving mycoplasma genitalium and collagen inhibitors. The TGFBR2 antibody is a valuable tool for researchers studying EGF-like growth factors, TGF-beta signaling pathways, chemokines, and other related areas of study. With its high specificity and neutralizing capabilities, this monoclonal antibody is an essential asset for any researcher in need of reliable and accurate results.</p>

<p>ApoA-I protein is a collagen-like protein that plays a crucial role in various biological processes. It is commonly used in research and diagnostic applications. This native protein can be targeted with monoclonal antibodies to detect autoantibodies or used as a control in experiments. ApoA-I protein contains amide groups, which are important for its structure and function. It interacts with phosphatases, growth factors, and endothelial growth inhibitors to regulate endothelial cell proliferation. Additionally, it can activate tyrosine kinase receptors, leading to downstream signaling pathways. ApoA-I protein is widely used in life sciences research for studying cardiovascular diseases, lipid metabolism, and other related fields.</p>

<p>The RXRB antibody is a highly specialized antibody that targets the RXR-beta protein, which is a cation channel and methyl transferase found in the nucleus of cells. This antibody is widely used in various research fields, including life sciences and medicine. It can be used in assays to detect the presence of RXR-beta protein or to study its function in different cellular processes.</p>

<p>Mouse monoclonal anti human BMP8b antibody</p>

<p>NUP155 antibody was raised using the middle region of NUP155 corresponding to a region with amino acids ISLHLQDICPLLYSTDDAICSKANELLQRSRQVQNKTEKERMLRESLKEY</p>

<p>DHRS2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LEHCGGVDFLVCSAGVNPLVGSTLGTSEQIWDKILSVNVKSPALLLSQLL</p>

<p>MMP16 antibody was raised using a synthetic peptide corresponding to a region with amino acids ALAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFHIRRKRYA</p>

<p>Rabbit polyclonal OR5H1 antibody</p>

<p>alpha Actinin 3 antibody was raised using the N terminal of ACTN3 corresponding to a region with amino acids  VQNFHTSWKDGLALCALIHRHRPDLIDYAKLRKDDPIGNLNTAFEVAEKY</p>

<p>Rabbit polyclonal IFNGR antibody (Tyr457)</p>

<p>The RAD51 antibody is a highly specialized monoclonal antibody that is used in Life Sciences research. It specifically targets the RAD51 protein, which plays a crucial role in DNA repair and recombination. This antibody has been extensively tested and validated for use in various applications, including Western blotting, immunoprecipitation, and immunofluorescence.</p>

<p>HS1BP3 antibody was raised in Rabbit using Human HS1BP3 as the immunogen</p>

<p>Rat monoclonal CD93 antibody (allophycocyanin)</p>

<p>SLCO1A2 antibody was raised using the middle region of SLCO1A2 corresponding to a region with amino acids AIIGPLIGLLLASFCANVYVDTGFVNTDDLIITPTDTRWVGAWWFGFLIC</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of JARID2 antibody, catalog no. 70R-5246</p>

<p>GTF2A1 antibody was raised in mouse using recombinant Human General Transcription Factor Iia, 1, 19/37Kda (Gtf2A1)</p>

<p>Mouse monoclonal DOK2 antibody</p>

<p>RSV protein is a multifunctional protein that possesses various characteristics and plays important roles in different biological processes. It functions as an endonuclease, cleaving DNA at specific sites. Additionally, RSV protein contains sugar moieties that contribute to its stability and function. Monoclonal antibodies targeting RSV protein have been developed for research purposes in the field of Life Sciences. These antibodies have been used to study the expression and localization of RSV protein in various tissues and cell types. Studies have shown that RSV protein is involved in regulating microvessel density, which is important for angiogenesis and tissue development. It has also been found to possess EGF-like domains, suggesting a potential role in cell signaling pathways. Furthermore, RSV protein exhibits hyaluronidase activity, which allows it to degrade hyaluronic acid, an important component of the extracellular matrix. This activity may contribute to tissue remodeling processes. In human serum, RSV protein has been found to interact</p>

<p>The ID1 antibody is a powerful tool in the field of Life Sciences. It is a neutralizing antibody that targets TGF-β1, a key protein involved in various cellular processes. This antibody can effectively block the activity of TGF-β1, preventing its interaction with receptors and downstream signaling pathways. Additionally, the ID1 antibody has been shown to inhibit the binding of TGF-β1 to fibrinogen, further highlighting its potential therapeutic applications.</p>

<p>CYP1A1 antibody was raised using the middle region of CYP1A1 corresponding to a region with amino acids FKDLNEKFYSFMQKMVKEHYKTFEKGHIRDITDSLIEHCQEKQLDENANV</p>

<p>NFKBIA antibody was raised in mouse using recombinant Nuclear Factor Of Kappa Light Polypeptide Gene Enhancer In B-Cells Inhibitor</p>

<p>The Cortactin antibody is a highly specialized antibody that plays a crucial role in various life sciences research applications. This antibody specifically targets the protein known as Cortactin, which is a key regulator of actin cytoskeleton dynamics.</p>

<p>Rabbit polyclonal NDUFV2 antibody (HRP)</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections, thanks to its bactericidal activity. This compound works by inhibiting bacterial growth through its binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its potency has been demonstrated through extensive research using the patch-clamp technique on human erythrocytes. Metabolically, it undergoes various transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>APRIN antibody was raised in mouse using recombinant Human Pds5, Regulator Of Cohesion Maintenance, Homolog B (S.Cerevisiae) (Pds5B)</p>

<p>Rabbit polyclonal ZC3HC1 antibody</p>

<p>Purified recombinant HP protein (His tag)</p>

<p>Rabbit Polyclonal CSFR antibody (Tyr809)</p>

<p>AURKB antibody was raised in mouse using recombinant human Aurora kinase B (1-344aa) purified from E. Coli as the immunogen.</p>

<p>Purified recombinant PHB2 protein (His tag)</p>

<p>CA2 antibody was raised in rabbit using the C terminal of CA2 as the immunogen</p>

<p>PPOX antibody was raised using the N terminal of PPOX corresponding to a region with amino acids SSERLGGWIRSVRGPNGAIFELGPRGIRPAGALGARTLLLVSELGLDSEV</p>

<p>The CD49e antibody is a powerful inhibitor that targets the beta-hairpin region of specific proteins. It has been extensively used in research studies in the field of Life Sciences, particularly in the area of Monoclonal Antibodies. This antibody exhibits cytotoxic effects and can also act as an agonist, stimulating specific cellular responses. The CD49e antibody has shown significant potential in blocking nuclear growth factors and inhibiting angiogenesis by targeting VEGF (vascular endothelial growth factor). Additionally, it has been found to have an impact on various signaling pathways, including c-myc and erythropoietin. Moreover, this antibody demonstrates antioxidant properties by reducing superoxide levels and enhancing insulin sensitivity. With its multifaceted characteristics, the CD49e antibody offers exciting opportunities for further exploration and application in biomedical research.</p>

<p>Mouse monoclonal Ig lambda light chain antibody (PE)</p>

<p>Mouse monoclonal CCM2 antibody</p>

<p>The N Cadherin antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets and binds to N Cadherin, a protein involved in cell-cell adhesion. This antibody has been extensively tested and validated for various applications, including immunohistochemistry, Western blotting, flow cytometry, and ELISA.</p>

<p>Purified Rabbit polyclonal MBTPS2 antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is highly effective in treating tuberculosis infections due to its strong bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Its potency has been demonstrated through various scientific techniques such as the patch-clamp technique on human erythrocytes.</p>

<p>Troponin T antibody (cardiac) was raised in mouse using free human cTnT as the immunogen.</p>

<p>Mouse monoclonal TCP11L2 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PTCH1 antibody, catalog no. 70R-6354</p>

<p>LRCH4 antibody was raised using a synthetic peptide corresponding to a region with amino acids LEEAVATGTLNLSNRRLKHFPRGAARSYDLSDITQADLSRNRFPEVPEAA</p>

<p>Mouse monoclonal UCK1 antibody</p>

<p>Rabbit Polyclonal IKK beta antibody (Tyr199)</p>

<p>The ANXA10 antibody is a highly specific monoclonal antibody that targets human serum. It exhibits cytotoxic activity by binding to actin filaments and disrupting their structure, leading to cell death. This antibody is commonly used in research and diagnostic applications, such as immunohistochemistry and flow cytometry. The ANXA10 antibody can be conjugated with various markers, including anti-CD33 antibody, epidermal growth factor (EGF), and anti-HER2 antibody, to enable visualization or quantification of specific proteins or cells of interest. Its colloidal properties make it suitable for use in various assays and techniques in the field of life sciences. Trust the ANXA10 antibody to provide accurate and reliable results for your research needs.</p>

<p>Rabbit polyclonal RUVBL1 antibody</p>

<p>ME1 antibody was raised in Rabbit using Human ME1 as the immunogen</p>

<p>MOSPD3 antibody was raised using the C terminal of MOSPD3 corresponding to a region with amino acids FLLFLLTGIVSVAFLLLPLPDELGSQLPQVLHVSLGQKLVAAYVLGLLTM</p>

<p>Purified Rabbit polyclonal ETNK1 antibody</p>

<p>The ATF2 antibody is a highly specialized antibody that is used in Life Sciences research. It is an inhibitor of the epidermal growth factor and acts as a cytotoxic agent against specific cells. This monoclonal antibody specifically targets ATF2, a transcription factor involved in cell growth and development. The ATF2 antibody can be used for various applications, including Western blotting, immunohistochemistry, and flow cytometry. It is available as both a recombinant antigen and as polyclonal antibodies. The neutralizing properties of this antibody make it an essential tool for studying the role of ATF2 in cellular processes. With its high specificity and affinity to the target protein, the ATF2 antibody provides accurate and reliable results in research experiments.</p>

<p>KIFC3 antibody was raised using the C terminal of KIFC3 corresponding to a region with amino acids EHLEWEPACQTPQPSARAHSAPSSGTSSRPGSIRRKLQPSGKSRPLPV</p>

<p>TMEM126B antibody was raised using the N terminal of TMEM126B corresponding to a region with amino acids AASMHGQPSPSLEDAKLRRPMVIEIIEKNFDYLRKEMTQNIYQMATFGTT</p>

<p>Rabbit polyclonal OR5B12 antibody</p>

<p>Mouse monoclonal ATP5B antibody</p>

<p>Rabbit polyclonal CaMK1A antibody (Thr177)</p>

<p>SLC5A4 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Rabbit polyclonal SERINC3 antibody</p>

<p>ULBP1 antibody was raised using the N terminal of ULBP1 corresponding to a region with amino acids MAAAASPAFLLCLPLLHLLSGWSRAGWVDTHCLCYDFIITPKSRPEPQWC</p>

<p>The Histone H3 antibody is a monoclonal antibody that specifically targets histone H3, a protein involved in the packaging of DNA into chromatin. This antibody is commonly used in research studies to investigate histone modifications and their impact on gene expression. It is particularly useful for techniques such as chromatin immunoprecipitation assay (ChIP) which allows researchers to study the interactions between proteins and DNA. The Histone H3 antibody has been extensively validated and is known for its high specificity and sensitivity. It has been successfully used in various applications including Western blotting, immunofluorescence, and immunohistochemistry. Researchers can rely on this antibody to accurately detect histone H3 acetylation levels and gain insights into epigenetic regulation of gene expression.</p>

<p>Purified recombinant STRADA protein (His tag)</p>

<p>KLC1 antibody was raised in Rabbit using Human KLC1 as the immunogen</p>