Prodotti biochimici e reagenti

<p>Recombinant Human AGA protein (His tag)</p>

<p>WDR8 antibody was raised using the middle region of WDR8 corresponding to a region with amino acids GCLSFPPPRAGAGPLPSSESKYEIASVPVSLQTLKPVTDRANPKMGIGML</p>

<p>ACAT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SYTRSKAAWEAGKFGNEVIPVTVTVKGQPDVVVKEDEEYKRVDFSKVPKL</p>

<p>AGBL5 antibody was raised using the C terminal of AGBL5 corresponding to a region with amino acids NLRAWMLKHVRNSRGLSSTLNVGVNKKRGLRTPPKSHNGLPVSCSENTLS</p>

<p>The FSHR antibody is a polyclonal antibody used in Life Sciences research. It is specifically designed to target the follicle-stimulating hormone receptor (FSHR). This antibody is widely used in various applications, including Western blotting, immunohistochemistry, and flow cytometry.</p>

<p>Mouse monoclonal CISD1 antibody</p>

<p>The TOP2B antibody is a highly specialized product in the field of Life Sciences. It is designed to neutralize the activity of TOP2B, an enzyme involved in DNA replication and repair. This antibody can be used in various applications, including Western blotting, immunoprecipitation, and immunofluorescence. It has been shown to effectively inhibit the activity of TOP2B in nuclear extracts and interfere with its function. Additionally, this antibody has been found to enhance the effects of interferon and trastuzumab, an anti-HER2 antibody. Its unique properties make it a valuable tool for researchers studying epidermal growth factor signaling, androgen receptor function, and other growth factor pathways. The TOP2B antibody is available for purchase and comes with detailed instructions for use.</p>

<p>LARS antibody was raised in Rabbit using Human LARS as the immunogen</p>

<p>Methandriol 3b Conjugate for use in immunoassays</p>

<p>Purified Polyclonal CYSLTR1 antibody</p>

<p>Purified recombinant Human STAMBPL1 protein (His tag)</p>

<p>Myoglobin antibody was raised in rabbit using human heart derived myoglobin as the immunogen.</p>

<p>Purified Polyclonal MAGEA6 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of APOBEC1 antibody, catalog no. 70R-4736</p>

<p>ARPC3 antibody was raised in Rabbit using Human ARPC3 as the immunogen</p>

<p>Purified recombinant Human EIF5A2 protein</p>

<p>MCM7 antibody was raised using the N terminal of MCM7 corresponding to a region with amino acids MALKDYALEKEKVKKFLQEFYQDDELGKKQFKYGNQLVRLAHREQVALYV</p>

<p>RPS7 antibody was raised using the middle region of RPS7 corresponding to a region with amino acids RIRVKLDGSRLIKVHLDKAQQNNVEHKVETFSGVYKKLTGKDVNFEFPEF</p>

<p>Mouse monoclonal MTRF1L antibody</p>

<p>PIGL antibody was raised using the N terminal of PIGL corresponding to a region with amino acids MEAMWLLCVALAVLAWGFLWVWDSSERMKSREQGGRLGAESRTLLVIAHP</p>

<p>IL10R Alpha antibody was raised using the N terminal of IL10RA corresponding to a region with amino acids GSVNLEIHNGFILGKIQLPRPKMAPANDTYESIFSHFREYEIAIRKVPGN</p>

<p>The CYR61 antibody is a highly specific and potent antibody that targets various antigens in the body. It has been extensively studied for its ability to bind to glp-1, myostatin, α-syn, hemoglobin, circumsporozoite protein, and other important molecules. This antibody can be used in a wide range of applications, including immunoassays and research experiments.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF765 antibody, catalog no. 70R-8901</p>

<p>TMED8 antibody was raised using the middle region of TMED8 corresponding to a region with amino acids EVMPVYRRDSHRDVQAGSHDYPGEGIYLLKFDNSYSLLRNKTLYFHIYYT</p>

<p>The ID3 antibody is a monoclonal antibody used in the field of Life Sciences. It specifically targets the ID3 receptor, which plays a crucial role in various biological processes such as collagen synthesis and receptor binding. This monoclonal antibody has been extensively studied for its potential therapeutic applications, including the treatment of autoimmune diseases and viral infections.</p>

<p>Factor X (HRP) was raised in Rabbit using human Factor X purified from plasma as the immunogen.</p>

<p>KCNAB2 antibody was raised in Rabbit using Human KCNAB2 as the immunogen</p>

<p>The PAP antibody is a polyclonal antibody that is used in various applications in the field of Life Sciences. It is highly effective in neutralizing the activity of phosphatase, an enzyme that plays a crucial role in many cellular processes. This antibody has been extensively tested and proven to be specific and reliable for detecting and quantifying target proteins. Additionally, it has shown excellent performance in assays involving excipients, epidermal growth factor, alpha-fetoprotein, liver microsomes, insulin antibody, electrode, colloidal phosphatase, globulin dopamine, and human serum. Whether you are conducting research or diagnostic experiments, the PAP antibody is a valuable tool that will provide accurate and consistent results.</p>

<p>B3GALT4 antibody was raised in Rabbit using Human B3GALT4 as the immunogen</p>

<p>Rabbit polyclonal PPIA antibody (HRP)</p>

<p>Rabbit polyclonal ISG15 antibody (FITC)</p>

<p>CD8 antibody (FITC) was raised in mouse using feline CD8 as the immunogen.</p>

<p>The p22 phox antibody is a highly reactive nuclear antibody that targets the p22 phox protein. This protein plays a crucial role in the activation of the p38 mitogen-activated protein kinase (MAPK) pathway, which is involved in various cellular processes. The p22 phox antibody is widely used in Life Sciences research to study the regulation of this pathway and its implications in different biological contexts.</p>

<p>OSGEP antibody was raised using the middle region of OSGEP corresponding to a region with amino acids EHRYRIFGETIDIAVGNCLDRFARVLKISNDPSPGYNIEQMAKRGKKLVE</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug from the rifamycins class. It is specifically designed to target tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by inhibiting bacterial growth through its binding to DNA-dependent RNA polymerase, which prevents transcription and replication. Extensive research has been conducted on its human activity using a patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically binds to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>The OC3 antibody is a highly specific monoclonal antibody that targets β-catenin, a key protein involved in cell signaling and development. It has been extensively studied for its ability to detect autoantibodies against oncogenic kinases, which are often associated with various types of cancer. The OC3 antibody recognizes different protein isoforms of β-catenin and has been shown to be reactive in a variety of experimental settings.</p>

<p>The STAT6 antibody is a specific antibody that binds to the receptor of STAT6, a growth factor involved in various cellular processes. This antibody is designed to recognize and bind to the specific disulfide bond on the STAT6 receptor, blocking its activity and preventing downstream signaling. The STAT6 antibody is a monoclonal antibody derived from human protein and has been extensively tested for its efficacy and specificity. It forms dimers with other antibodies, such as afatinib, to enhance its cytotoxic effects. In Life Sciences research, the STAT6 antibody is commonly used for immunohistochemistry, Western blotting, and hybridization studies. It can also be used in diagnostic applications to detect the presence of alpha-msh or other related proteins. Additionally, polyclonal antibodies can be generated using the STAT6 antibody as an antigen for immunization. These polyclonal antibodies are valuable tools for studying the role of STAT6 in various biological processes.</p>

<p>TNF alpha antibody was raised in mouse using human recombinant tumor necrosis factor alpha as the immunogen.</p>

<p>Rabbit polyclonal Cyclin E1 antibody; PBS buffer without Mg2+ and Ca2+</p>

<p>Rabbit polyclonal OR4X1 antibody</p>

<p>EIF4H antibody was raised in Rabbit using Human EIF4H as the immunogen</p>

<p>Rabbit polyclonal PKC mu antibody (Ser910)</p>

<p>Purified recombinant Human TBCEL protein (His tag)</p>

<p>Rabbit polyclonal PLA2G4E antibody</p>

<p>Rabbit polyclonal TSPYL4 antibody</p>

<p>BHMT antibody was raised in Mouse using a purified recombinant fragment of BHMT expressed in E. coli as the immunogen.</p>

<p>GABRB1 antibody was raised in rabbit using the middle region of GABRB1 as the immunogen</p>

<p>Rabbit polyclonal MRPL18 antibody</p>

<p>Rabbit polyclonal SGCA antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Plxdc2 antibody, catalog no. 70R-8859</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PNPT1 antibody, catalog no. 70R-4670</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ST6GALNAC2 antibody, catalog no. 70R-7453</p>

<p>MTIF3 antibody was raised using the middle region of MTIF3 corresponding to a region with amino acids AVQGGKALMCVLRALSKNEEKAYKETQETQERDTLNKDHGNDKESNVLHQ</p>

<p>C14orf126 antibody was raised in rabbit using the middle region of C14orf126 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RGS4 antibody, catalog no. 70R-5834</p>

<p>Rabbit polyclonal CD2L1 antibody</p>

<p>LOC652618 antibody was raised using the N terminal Of Loc652618 corresponding to a region with amino acids MAGRSGHVDVVNERRLKPLYDNLDNGNYKMALQAADKLLKKHKDLHCAKV</p>

<p>EHD1 antibody was raised in rabbit using the middle region of EHD1 as the immunogen</p>

<p>Rabbit Polyclonal SOX9 antibody (Ser181)</p>

<p>Rabbit polyclonal Aldolase antibody (FITC)</p>

<p>GOSR1 antibody was raised in rabbit using the C terminal of GOSR1 as the immunogen</p>

<p>COL25A1 antibody was raised in Rabbit using Human COL25A1 as the immunogen</p>

<p>Purified Bovine IgG (Fab'2) FITC conjugate</p>

<p>NXF5 antibody was raised in rabbit using the C terminal of NXF5 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NCKIPSD antibody, catalog no. 70R-9799</p>

<p>The FGFR2 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets the fibroblast growth factor receptor 2 (FGFR2), a protein that plays a crucial role in cell growth and development. This antibody can be used in various assays to detect and measure the levels of FGFR2 in different biological samples.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Ppp2r5e antibody, catalog no. 70R-9426</p>

<p>UBN1 antibody was raised in mouse using recombinant Ubinuclein 1 (Ubn1)</p>

<p>The PRDX4 antibody is a highly specific monoclonal antibody that targets and binds to peroxiredoxin-4 (PRDX4), an important antioxidant enzyme. This antibody is widely used in life sciences research to study the role of PRDX4 in various cellular processes.</p>

<p>Rabbit polyclonal p15 INK antibody</p>

<p>RGR antibody is a highly specialized antibody that targets the insulin-like growth factor-I (IGF-I). It belongs to the class of antibodies known as adeno-associated antibodies, which have been shown to have an inhibitory effect on adeno-associated viral (AAV) vectors. The RGR antibody specifically neutralizes the activity of CXCL13, a chemokine involved in various biological processes. In the field of Life Sciences, this antibody has demonstrated an anti-angiogenic effect by inhibiting blood vessel formation. Additionally, it has shown promise as a potential therapeutic agent for conditions such as fibrosis and cancer due to its anti-fibrotic properties and its ability to modulate the behavior of mesenchymal stem cells. The RGR antibody is widely used in research and is available as a polyclonal antibody, making it a valuable tool for scientists studying IGF-I-related pathways.</p>

<p>Purified Polyclonal EWS antibody</p>

<p>HSV1/HSV2 antibody (FITC) was raised in rabbit using Strain F as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ISG15 antibody, catalog no. 70R-9759</p>

<p>The STAT1 antibody is a specific antibody used in life sciences research. It targets the STAT1 protein, which plays a crucial role in various cellular processes such as immune response and cell growth. This monoclonal antibody can be used to study the activation of p38 MAPK signaling pathway and its effects on mesenchymal stem cells. Additionally, it has been shown to neutralize the effects of hepcidin, a key regulator of iron metabolism. The STAT1 antibody can also be used to investigate the role of interleukin-6 and cannabinoid receptors in different biological systems. Its genotoxic properties make it an essential tool for studying DNA damage and repair mechanisms. With its high specificity and potency, this antibody is widely used by researchers in various fields of life sciences.</p>

<p>HDL antibody was raised in mouse using purified human HDL as the immunogen.</p>

<p>alpha 2 Macroglobulin antibody was raised in goat using human alpha 2 Macroglobulin purified from plasma as the immunogen.</p>

<p>MSH6 antibody was raised in Mouse using a purified recombinant fragment of MSH6 expressed in E. coli as the immunogen.</p>

<p>Fmoc-N-Lys-(dPEG®4-Biotin)-OH-(Acid) is an ion channel activator with a molecular weight of 921.5 Da. It has been shown to activate the voltage-gated potassium channels Kv1.2 and Kv1.3 in rat cortical neurons, and inhibit the activity of the voltage-gated sodium channels Nav1.6, Nav1.7, and Nav1.8 in rat dorsal root ganglia neurons. In addition, Fmoc-N-Lys-(dPEG®4-Biotin)-OH-(Acid) has been shown to activate the calcium release activated calcium channels (CRACs) in human erythrocytes and induce the release of arachidonic acid from human platelets. It is a high purity reagent for research purposes only, not for use in humans or animals for any reason other than scientific research</p>

<p>Thymopoietin antibody was raised using the middle region of TMPO corresponding to a region with amino acids EKKLLKLREQGTESRSSTPLPTISSSAENTRQNGSNDSDRYSDNEEDSKI</p>

<p>The SHH antibody is a highly specialized drug antibody used in Life Sciences. It belongs to the class of agonist proteins and is available as both monoclonal and polyclonal antibodies. This antibody is specifically designed to target and bind to the Sonic Hedgehog (SHH) protein, which plays a crucial role in various biological processes such as cell growth and development.</p>

<p>Rabbit polyclonal CASP7 antibody</p>

<p>Rabbit polyclonal REC8 antibody</p>

<p>MEPCE antibody was raised in Rabbit using Human MEPCE as the immunogen</p>

<p>Purified recombinant BCDIN3D protein (His tag)</p>

<p>KPNA6 antibody was raised in Rabbit using Human KPNA6 as the immunogen</p>

<p>The hCG alpha antibody is a phosphatase that belongs to the group of monoclonal antibodies. It specifically targets and binds to the hCG (human chorionic gonadotropin) alpha subunit. This antibody has been shown to have high affinity and specificity for the hCG alpha subunit, making it an ideal tool for various applications in life sciences research. The hCG alpha antibody can be used in assays to detect and quantify hCG levels, such as pregnancy tests. It can also be used in immunohistochemistry and immunofluorescence experiments to study the expression and localization of hCG alpha subunit in tissues and cells. The use of this monoclonal antibody, along with other complementary reagents like alkaline phosphatases or insulin antibodies, allows for accurate and reliable detection of hCG alpha subunit in different experimental setups. With its unique properties and versatility, the hCG alpha antibody is a valuable tool for researchers working in the field of reproductive biology</p>

<p>Purified Rabbit polyclonal CCDC99 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TRAPPC1 antibody, catalog no. 70R-3979</p>

<p>Rabbit polyclonal BMP3 antibody</p>

<p>The Fractin antibody is a highly specialized monoclonal antibody that has neutralizing properties against androgen. It acts as an inhibitor of cytotoxic growth factors by binding to specific proteins, such as glycoproteins and chemokines. This antibody is commonly used in research settings to study the effects of these growth factors on various cell types.</p>

<p>Armenian Hamster monoclonal CD80 antibody (biotin)</p>

<p>HERV antibody was raised in rabbit using residues 42-50 [QRPGNIDAPC] of the HERV protein as the immunogen.</p>

<p>Goat anti-monkey IgM was raised in goat using monkey IgM mu heavy chain as the immunogen.</p>

<p>Rabbit Polyclonal IKK beta antibody (Tyr199)</p>

<p>Mouse monoclonal Bt Cry1F antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RPS6KB1 antibody, catalog no. 70R-3692</p>

<p>Rat monoclonal IgG2b Isotype Control Fc fusion protein (FITC)</p>

<p>The CD32 antibody is a highly versatile test compound that has a wide range of applications in various fields. It is a monoclonal antibody that specifically targets the CD32 receptor, which plays a crucial role in immune response regulation. This antibody can be used for research purposes, diagnostic tests, and therapeutic interventions.</p>

<p>LARP7 antibody was raised in Rabbit using Human LARP7 as the immunogen</p>