Prodotti biochimici e reagenti
I biochimici e i reagenti sono sostanze fondamentali per la ricerca e lo sviluppo in campi come la biotecnologia, la biologia molecolare, la farmacologia e la medicina. Questi prodotti sono essenziali per una varietà di applicazioni, tra cui la sintesi di composti, l'analisi di campioni biologici, la ricerca sui processi metabolici e la produzione di farmaci. Presso CymitQuimica offriamo un'ampia selezione di biochimici e reagenti di alta qualità e purezza, adatti a diverse esigenze scientifiche e industriali. Il nostro catalogo include enzimi, anticorpi, acidi nucleici, amminoacidi e molti altri prodotti, tutti progettati per supportare i ricercatori e i professionisti nei loro progetti di ricerca e sviluppo, garantendo risultati affidabili e riproducibili.
Sottocategorie di "Prodotti biochimici e reagenti"
- Biomolecole(99.185 prodotti)
- Per obiettivo biologico(99.150 prodotti)
- Per uso/effetti farmacologici(6.789 prodotti)
- Composti relativi alla crioconservazione e crioconservanti(21 prodotti)
- Disinfettanti, additivi per fluidi per bagni di riscaldamento e composti correlati(28 prodotti)
- Ormoni(346 prodotti)
- Biologia vegetale(6.764 prodotti)
- Metaboliti secondari(14.307 prodotti)
Trovati 130581 prodotti di "Prodotti biochimici e reagenti"
Ordinare per
Purezza (%)
0
100
|
0
|
50
|
90
|
95
|
100
LY 2584702
CAS:<p>Inhibitor of ribosomal protein kinase p70S6K</p>Formula:C21H19F4N7Purezza:Min. 95%Peso molecolare:445.42 g/molEce2 antibody
<p>Ece2 antibody was raised in rabbit using the middle region of Ece2 as the immunogen</p>Purezza:Min. 95%iNOS antibody
<p>The iNOS antibody is a highly specialized polyclonal antibody that targets the inducible nitric oxide synthase (iNOS). It is commonly used in life sciences research to study the role of iNOS in various biological processes. This antibody specifically binds to iNOS and can be used for applications such as immunohistochemistry, western blotting, and flow cytometry.</p>Hepatitis C Virus antibody
<p>Hepatitis C virus antibody was raised in mouse using hepatitis C core antigen as the immunogen.</p>Goat anti Donkey IgG (H + L) (HRP)
<p>This antibody reacts with heavy chains on Donkey IgG and light chains on all Donkey immunoglobulins.</p>Purezza:Min. 95%SLCO5A1 antibody
<p>SLCO5A1 antibody was raised in rabbit using the middle region of SLCO5A1 as the immunogen</p>Purezza:Min. 95%GALNT6 antibody
<p>GALNT6 antibody was raised using a synthetic peptide corresponding to a region with amino acids EIIPCSVVGHVFRTKSPHTFPKGTSVIARNQVRLAEVWMDSYKKIFYRRN</p>Purezza:Min. 95%KIF12 antibody
<p>KIF12 antibody was raised using the N terminal of KIF12 corresponding to a region with amino acids SLGSPRPLPVRWNKTRGFYVEQLRVVEFGSLEALMELLQTGLSRRRNSAH</p>Purezza:Min. 95%KIAA1468 antibody
<p>KIAA1468 antibody was raised in Rabbit using Human KIAA1468 as the immunogen</p>MBP antibody
<p>MBP antibody was raised using the middle region of MBP corresponding to a region with amino acids FKDRPSESDELQTIQEDSAATSESLDVMASQKRPSQRHGSKYLATASTMD</p>PPM1G antibody
<p>The PPM1G antibody is a highly potent inhibitor that belongs to the class of antibodies used in Life Sciences. It exhibits an inhibitory effect on phosphatase activity, making it an essential tool for research and industrial applications. This monoclonal antibody specifically targets PPM1G, a phosphatase enzyme involved in various cellular processes. The PPM1G antibody can be used for immobilization purposes or as part of molecular modeling studies. Its specificity and high affinity make it a valuable asset in the field of antibody-based research and development.</p>HAS3 antibody
<p>HAS3 antibody was raised using the C terminal of HAS3 corresponding to a region with amino acids SDTVLDPACTIEMLRVLEEDPQVGGVGGDVQPPGKGMAVEDDQVQAAQVR</p>Purezza:Min. 95%ADAM2 antibody
<p>ADAM2 antibody was raised using a synthetic peptide corresponding to a region with amino acids PHDVAFLLVYREKSNYVGATFQGKMCDANYAGGVVLHPRTISLESLAVIL</p>Purezza:Min. 95%DHX16 antibody
<p>DHX16 antibody was raised using a synthetic peptide corresponding to a region with amino acids KYQLVLEEEETIEFVRATQLQGDEEPSAPPTSTQAQQKESIQAVRRSLPV</p>Purezza:Min. 95%CD3 antibody (biotin)
<p>CD3 antibody (biotin) was raised in mouse using the epsilon chain of CD3/T-cell antigen receptor complex as the immunogen.</p>NGAL antibody
<p>The NGAL antibody is a monoclonal antibody that targets the glycoprotein NGAL (Neutrophil Gelatinase-Associated Lipocalin). NGAL is involved in various biological processes, including collagen metabolism, glutamate homeostasis, and regulation of TGF-beta signaling. The NGAL antibody specifically recognizes sugar moieties present on the surface of NGAL and can be used for various applications in Life Sciences.</p>FXN antibody
<p>The FXN antibody is a growth factor that belongs to the family of epidermal growth factor-like proteins. It is a cytotoxic conjugate used in Life Sciences research, specifically in the field of Monoclonal Antibodies. This antibody targets specific proteins, such as basic protein, and has cytotoxic properties that can inhibit cell growth and division. The FXN antibody can be used in various applications, including the development of inhibitors for specific proteins or as a tool to study autoantibodies. It is also commonly used in combination with other antibodies, such as anti-CD33 antibody, to enhance its effectiveness. With its high specificity and potency, the FXN antibody is a valuable tool for researchers in the field of Life Sciences.</p>CSF2 antibody
<p>CSF2 antibody was raised in Mouse using a purified recombinant fragment of human CSF2(aa18-144) expressed in E. coli as the immunogen.</p>CD4 antibody (PE)
<p>CD4 antibody (PE) was raised in mouse using P815 cell transfected with human CD4 as the immunogen.</p>BIN3 antibody
<p>The BIN3 antibody is a highly specialized monoclonal antibody that targets specific growth factors and proteins in the body. It has been extensively studied for its ability to neutralize the effects of hepatocyte growth factor, collagen, and other proteins involved in cell growth and development. This antibody has also shown promising results in inhibiting multidrug resistance in cancer cells by targeting cytochrome enzymes involved in drug metabolism. Additionally, the BIN3 antibody has been found to interact with fibronectin and low-density lipoprotein receptors, suggesting potential therapeutic applications in cardiovascular diseases. With its unique properties and specificity, this monoclonal antibody holds great promise for future research and development in various fields of medicine.</p>Akt antibody (Ser124)
<p>Akt, or Protein Kinase B (PKB), is a kinase crucial for cell growth, survival, metabolism, and proliferation within the PI3K/Akt/mTOR pathway, which responds to external signals like growth factors. Activated through phosphorylation at specific sites, Akt influences key cellular processes by promoting cell survival, aiding protein synthesis through mTOR activation, regulating glucose metabolism, and supporting blood vessel formation and cell movement. Its hyperactivation is common in cancers, making it a target for cancer therapies, while its role in glucose regulation links it to insulin resistance and type 2 diabetes.</p>PLAT antibody
<p>PLAT antibody is a test compound used to detect the presence of autoantibodies in samples. These autoantibodies are antibodies that target and attack the body's own tissues or cells. The PLAT antibody can be used in various assays and experiments to study the role of these autoantibodies in different diseases and conditions.</p>GPR160 antibody
<p>GPR160 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>Purezza:Min. 95%DMBX1 antibody
<p>DMBX1 antibody was raised in rabbit using the middle region of DMBX1 as the immunogen</p>Purezza:Min. 95%Histone H2B antibody
<p>The Histone H2B antibody is a valuable tool in Life Sciences research. This polyclonal antibody specifically targets Histone H2B, a protein involved in DNA packaging and gene regulation. It has high affinity for Histone H2B and shows minimal cross-reactivity with other proteins.</p>Smad3 antibody
<p>The Smad3 antibody is a polyclonal antibody that specifically targets the growth hormone receptor. It is commonly used in life sciences research to study the activation of various signaling pathways. This antibody has been shown to neutralize the effects of progesterone, dopamine, and chemokines by binding to their respective receptors. The Smad3 antibody can be used in various experimental techniques such as immunohistochemistry, Western blotting, and ELISA. It is produced using high-quality excipients and undergoes rigorous quality control measures to ensure its efficacy and specificity. With its ability to detect and inhibit specific proteins, the Smad3 antibody is an invaluable tool for researchers in the field of molecular biology.</p>Cofilin 1 antibody
<p>Cofilin 1 antibody was raised in mouse using recombinant human Cofilin 1 (1-166aa) purified from E. coli as the immunogen.</p>Lactoferrin protein (Apo)
<p>Purified native Human Lactoferrin protein</p>Purezza:≥ 95% As Determined By Sds-Page.Theiler's Murine Encephalomyelitis virus protein
<p>Purified native Theiler's Murine Encephalomyelitis virus protein</p>Purezza:Min. 95%Cytokeratin 8+18 antibody (Prediluted for IHC)
<p>Mouse monoclonal Cytokeratin 8+18 antibody (Prediluted for IHC)</p>Purezza:Min. 95%GFAP antibody
<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections, thanks to its bactericidal activity. By binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth by preventing transcription and replication. Additionally, it has been shown to have a high frequency of human activity using a patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Rifapentine also specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>Purezza:Min. 95%YWHAZ antibody
<p>YWHAZ antibody was raised using the middle region of Ywhaz corresponding to a region with amino acids FDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN</p>Notch 4 homolog antibody
<p>Notch 4 homolog antibody was raised in rabbit using a synthetic peptide representing an internal region of the human NOTCH homolog 4 (NOTCH4) protein as the immunogen.</p>Purezza:Min. 95%Bovine Red Blood Cells
<p>Bovine Red Blood Cells are a vital component in the field of Life Sciences and have various applications, especially in Veterinary Applications. These cells can be used as a fluorophore for imaging studies and other research purposes. The emission properties of Bovine Red Blood Cells make them suitable for use in fluorescence-based assays.</p>Purezza:Min. 95%4-Azidophlorizin
CAS:<p>High affinity probe for glucose transporter; photoaffinity label</p>Formula:C21H23N3O9Purezza:Min. 95%Peso molecolare:461.42 g/molG6PC antibody
<p>G6PC antibody was raised using the N terminal of G6PC corresponding to a region with amino acids NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM</p>CLAN antibody
<p>CLAN antibody was raised in rabbit using N terminus sequence MNFIKDNSRA LIQRMGM of the A and B isoforms of the human CLAN protein as the immunogen.</p>Purezza:Min. 95%Il6 protein
<p>Il6 protein is an inhibitory factor that belongs to the group of proteins and antigens. It can be used in combination with adalimumab or other inhibitors for therapeutic purposes. Il6 protein has been shown to have chemokine and epidermal growth factor properties, as well as anti-VEGF (vascular endothelial growth factor) and neutralizing effects on TNF-α (tumor necrosis factor-alpha). It also exhibits activity against interleukins and interferons. Additionally, Il6 protein has carbonic properties and can be used in conjugated proteins for various applications, including the treatment of endothelial growth disorders.</p>Purezza:Min. 95%α Synuclein 195 protein
<p>MDVFMKGLSK AKEGVVAAAE KTKQGVAEAA GKTKEGVLYV GSKTKEGVVH GVATVAEKTK EQVTNVGGAV VTGVTAVAQK TVEGAGSIAA ATGFV</p>Purezza:Min. 95%SOX12 antibody
<p>SOX12 antibody was raised in mouse using recombinant Human Sry (Sex Determining Region Y)-Box 12</p>Cytochrome P450 2D6 antibody
<p>The Cytochrome P450 2D6 antibody is a highly specialized monoclonal antibody that has the unique ability to neutralize the activity of the Cytochrome P450 2D6 enzyme. This enzyme plays a crucial role in drug metabolism and can affect the efficacy and safety of various medications.</p>ASB6 antibody
<p>ASB6 antibody was raised using the middle region of ASB6 corresponding to a region with amino acids LKMAELGLTRAADVLLRHGANLNFEDPVTYYTALHIAVLRNQPDMVELLV</p>Purezza:Min. 95%AD80
CAS:<p>AD80 is a multi-kinase inhibitor that prevents the phosphorylation and activation of tyrosine kinases. It has been shown to inhibit the proliferation of leukemia cells in vivo. AD80 has been found to be effective against glioblastoma cells and other cancer types, such as melanoma, breast cancer, and lung cancer. AD80 inhibits protein synthesis by binding to the ATP-binding site of the enzyme kinase domain. The solubility data for AD80 shows that it is highly soluble in water and organic solvents.</p>Formula:C22H19F4N7OPurezza:Min. 95%Peso molecolare:473.43 g/molCalicin antibody
<p>Calicin antibody was raised using the C terminal of CCIN corresponding to a region with amino acids TTSVPVLPNSCPLDVSHAICSIGDSKVFVCGGVTTASDVQTKDYTINPNA</p>amyloid P-IN-1
CAS:<p>Amyloid P-IN-1 is a ligand that binds to the amyloid peptide and inhibits the formation of amyloids. Amyloid P-IN-1 has been shown to be an orally active molecule in humans, with a low oral bioavailability due to its physicochemical properties. The affinity for amyloid P-IN-1 to bind to the amyloid peptide is high and it has been shown to inhibit the growth of amyloids in vitro and in vivo. Amyloid P-IN-1 also has pharmacological effects on ligands, such as binding to receptors on cells, which may account for its potential use as a therapeutic agent.</p>Formula:C30H44N2O14Purezza:Min. 95%Peso molecolare:656.68 g/molPIGA antibody
<p>PIGA antibody was raised using the middle region of PIGA corresponding to a region with amino acids SVKSLCEGLEKAIFQLKSGTLPAPENIHNIVKTFYTWRNVAERTEKVYDR</p>Purezza:Min. 95%WWP2 antibody
<p>WWP2 antibody was raised using the middle region of WWP2 corresponding to a region with amino acids TKTTTWERPLPPGWEKRTDPRGRFYYVDHNTRTTTWQRPTAEYVRNYEQW</p>CCNB1 antibody
<p>CCNB1 antibody was raised in Mouse using a purified recombinant fragment of human CCNB1 expressed in E. coli as the immunogen.</p>ZBTB9 antibody
<p>ZBTB9 antibody was raised in rabbit using the C terminal of ZBTB9 as the immunogen</p>Purezza:Min. 95%C5ORF24 antibody
<p>C5ORF24 antibody was raised using the middle region of C5Orf24 corresponding to a region with amino acids SIEIKDELKKKKNLNRSGKRGRPSGTTKSAGYRTSTGRPLGTTKAAGFKT</p>
