Prodotti biochimici e reagenti
I biochimici e i reagenti sono sostanze fondamentali per la ricerca e lo sviluppo in campi come la biotecnologia, la biologia molecolare, la farmacologia e la medicina. Questi prodotti sono essenziali per una varietà di applicazioni, tra cui la sintesi di composti, l'analisi di campioni biologici, la ricerca sui processi metabolici e la produzione di farmaci. Presso CymitQuimica offriamo un'ampia selezione di biochimici e reagenti di alta qualità e purezza, adatti a diverse esigenze scientifiche e industriali. Il nostro catalogo include enzimi, anticorpi, acidi nucleici, amminoacidi e molti altri prodotti, tutti progettati per supportare i ricercatori e i professionisti nei loro progetti di ricerca e sviluppo, garantendo risultati affidabili e riproducibili.
Sottocategorie di "Prodotti biochimici e reagenti"
- Biomolecole(99.185 prodotti)
- Per obiettivo biologico(99.150 prodotti)
- Per uso/effetti farmacologici(6.789 prodotti)
- Composti relativi alla crioconservazione e crioconservanti(21 prodotti)
- Disinfettanti, additivi per fluidi per bagni di riscaldamento e composti correlati(28 prodotti)
- Ormoni(346 prodotti)
- Biologia vegetale(6.764 prodotti)
- Metaboliti secondari(14.307 prodotti)
Trovati 130581 prodotti di "Prodotti biochimici e reagenti"
Ordinare per
Purezza (%)
0
100
|
0
|
50
|
90
|
95
|
100
Granulocytes antibody
<p>The Granulocytes antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is commonly utilized in various assays, including the agglutination assay, to study the behavior and functions of granulocytes. This antibody has shown antiangiogenic properties by inhibiting the formation of new blood vessels. Additionally, it binds to actin filaments and disrupts their organization, leading to changes in cell morphology. The Granulocytes antibody also interacts with fibrinogen and growth factors, affecting their signaling pathways. In studies, this antibody has been shown to modulate chemokine receptors and inhibit the binding of ketanserin and dopamine. Furthermore, it has demonstrated its effectiveness as an endothelial growth inhibitor and has implications in erythropoietin production. Its interaction with collagen has also been observed, suggesting a potential role in extracellular matrix remodeling.</p>PD 118057
CAS:<p>PD 118057 is a drug that is used to treat congestive heart failure. It is an inhibitor of histone deacetylase (HDAC) and has been shown to be effective in experimental models of cardiac hypertrophy. The drug has been shown to have a depressant effect on the heart, which may be due to its ability to inhibit the production of potassium ion channels that are responsible for maintaining the resting membrane potential. PD 118057 has also been shown to decrease the number of damaged ventricular myocytes in animal models.</p>Formula:C21H17Cl2NO2Purezza:Min. 95%Peso molecolare:386.27 g/molCRAC inhibitor 44
CAS:<p>CRAC inhibitor 44 is a guanine nucleotide-binding protein that inhibits the activity of ABCG2, which is an important drug transporter in the blood-brain barrier. CRAC inhibitor 44 binds to the ABCG2 transporter and prevents it from transporting drugs across the blood-brain barrier. This inhibition leads to neuronal death and has been shown to be effective against oxidative injury. The binding of CRAC inhibitor 44 to ABCG2 also inhibits calcium binding and autophagy, which are important processes in cell survival. In vitro experiments using a polymerase chain reaction (PCR) system on human cells have shown that CRAC inhibitor 44 can inhibit transcriptional regulation by preventing mRNA production. Histological analysis of mice treated with CRAC inhibitor 44 showed that this drug led to brain damage due to its ability to inhibit DNA repair enzymes, such as polymerase chain reaction (PCR) activity and transcriptional regulation.</p>Formula:C26H41N3O5Purezza:Min. 95%Peso molecolare:475.6 g/molBHMT antibody
<p>The BHMT antibody is a monoclonal antibody that targets the cation channel inhibitors. It is used to detect autoantibodies against octanoyltransferase, which is an enzyme involved in the metabolism of carnitine. BHMT antibody can be used as part of diagnostic tests to identify individuals with deficiencies in this enzyme or those who may benefit from targeted therapies. This antibody is also commonly used in research settings to study the role of cation channels and methyl transferases in various diseases and conditions. With its high specificity and sensitivity, the BHMT antibody is a valuable tool for scientists and healthcare professionals alike.</p>Osteocalcin antibody
<p>The Osteocalcin antibody is a highly specialized product in the field of Life Sciences. It plays a crucial role in various biological processes, including bone formation and regulation of energy metabolism. This antibody specifically targets osteocalcin, a glycoprotein that is predominantly found in bone tissues.</p>VTN Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of VTN antibody, catalog no. 70R-9584</p>Purezza:Min. 95%AFAP1L2 antibody
<p>AFAP1L2 antibody was raised in rabbit using the N terminal of AFAP1L2 as the immunogen</p>BIN3 antibody
<p>BIN3 antibody is a monoclonal antibody that specifically targets the BIN3 protein complex. This antibody has been shown to have cytotoxic effects on cancer cells by interfering with the interaction between BIN3 and other biomolecules involved in cell survival and proliferation. The BIN3 antibody also modulates the activity of nuclear receptors, including mineralocorticoid receptors, which play a role in regulating blood pressure and electrolyte balance. Additionally, this antibody has been found to inhibit the release of pro-inflammatory cytokines such as interferon and interleukin-6. The glycosylation of the BIN3 antibody enhances its stability and bioavailability, making it an effective therapeutic option for various diseases.</p>TUBB3 antibody
<p>The TUBB3 antibody is a highly specialized product in the field of Life Sciences. It belongs to the family of monoclonal antibodies and has been designed to specifically target and neutralize natriuretic growth factor. This antibody is widely used in research laboratories and pharmaceutical companies for its ability to inhibit the activity of low-density family kinase inhibitors.</p>CD44 antibody
<p>The CD44 antibody is a highly versatile polyclonal antibody that has various applications in the field of Life Sciences. It is commonly used for immobilization and detection purposes in immunoassays. This antibody specifically targets the CD44 protein, which is involved in cell adhesion, migration, and signaling.</p>Purezza:Min. 95%HSP70-IN-1
CAS:<p>HSP70-IN-1 is a recombinant protein that is expressed in E. coli and purified with a His tag. It is an activator of the Hsp70 protein, which is involved in the folding of other proteins and the assembly of multiprotein complexes. This protein has been shown to bind to a variety of ligands, including ion channels, receptors, and ligands.</p>Formula:C24H28N6O2SPurezza:Min. 95%Peso molecolare:464.58 g/molpan Cytokeratin antibody
<p>pan Cytokeratin antibody was raised in Mouse using a purified recombinant fragment of Cytokeratin 5 expressed in E. coli as the immunogen.</p>Inhibin α antibody
<p>Inhibin Alpha antibody was raised using the N terminal of INHA corresponding to a region with amino acids GLAQEAEEGLFRYMFRPSQHTRSRQVTSAQLWFHTGLDRQGTAASNSSEP</p>Purezza:Min. 95%NUDT12 antibody
<p>NUDT12 antibody was raised using a synthetic peptide corresponding to a region with amino acids LALAVSTEIKVDKNEIEDARWFTREQVLDVLTKGKQQAFFVPPSRAIAHQ</p>PDGFRb antibody
<p>The PDGFRb antibody is a highly specialized medicament used in the field of Life Sciences. It is a monoclonal antibody that specifically targets and inhibits the protein kinase activity of PDGFRb (Platelet-Derived Growth Factor Receptor Beta). This antibody has been extensively studied and proven to be effective in various research applications.</p>[Gln18]-Platelet Factor 4 (15-22) (human)
CAS:<p>Please enquire for more information about [Gln18]-Platelet Factor 4 (15-22) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C38H69N15O13Peso molecolare:944.06 g/molLiraglutide
<p>Liraglutide is sold under the brand name €˜Victoza' and is a medication used to treat diabetes mellitus type 2 and obesity.Liraglutide binds to and activates the GLP-1 (glucagon-like peptide-1) receptor to bring about an increase in insulin secretion and a decrease in glucagon secretion and gastric emptying.</p>Peso molecolare:3,748.9 g/moldPEG®4 Biotin Acid
CAS:<p>dPEG®4 Biotin Acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. dPEG®4 Biotin Acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Purezza:Min. 95%Peso molecolare:491.6 g/molWnt10a Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Wnt10a antibody, catalog no. 70R-8497</p>Purezza:Min. 95%Crystallin α B antibody
<p>Crystallin Alpha B antibody was raised using the C terminal of CRYAB corresponding to a region with amino acids KYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVT</p>SLC25A38 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLC25A38 antibody, catalog no. 70R-6469</p>Purezza:Min. 95%PKC δ antibody
<p>The PKC delta antibody is a powerful tool used in life sciences research. It specifically targets and detects the protein kinase C delta (PKC δ), which plays a crucial role in cell signaling pathways. This polyclonal antibody can be used to study various biological processes, including androgen and epidermal growth factor signaling, histidine phosphorylation, and cholinergic neurotransmission.</p>Purezza:Min. 95%HEYL antibody
<p>HEYL antibody was raised in mouse using recombinant Human Hairy/Enhancer-Of-Split Related With Yrpw Motif-Like</p>A1BG Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of A1BG antibody, catalog no. 70R-8009</p>Purezza:Min. 95%SHH antibody
<p>SHH antibody was raised in Mouse using a purified recombinant fragment of human SHH expressed in E. coli as the immunogen.</p>ARSH Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ARSH antibody, catalog no. 70R-6266</p>Purezza:Min. 95%OR2H2 antibody
<p>OR2H2 antibody was raised in rabbit using the C terminal of OR2H2 as the immunogen</p>Purezza:Min. 95%P2RX2 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of P2RX2 antibody, catalog no. 70R-5145</p>Purezza:Min. 95%Tubulin β antibody
<p>The Tubulin beta antibody is a highly effective neutralizing agent that targets the carbonic region of the tubulin beta protein. This monoclonal antibody has been specifically designed to bind to and inhibit the activity of tubulin beta, which plays a crucial role in cell division and growth. By blocking the function of tubulin beta, this antibody prevents the formation of microtubules, which are essential for cellular processes such as mitosis and intracellular transport.</p>COL4A2 antibody
<p>The COL4A2 antibody is an inhibitory factor that targets chemokines and plays a crucial role in various biological processes. This monoclonal antibody specifically binds to annexin A2, a protein involved in cell adhesion and signal transduction. By neutralizing the activity of annexin A2, the COL4A2 antibody can inhibit the migration and invasion of cancer cells. Additionally, this antibody has been shown to have natriuretic effects, promoting diuresis and reducing blood pressure. In Life Sciences research, the COL4A2 antibody is commonly used as a tool to study autoantibodies and their role in disease development. Whether you need a monoclonal or polyclonal antibody, the COL4A2 antibody is an essential reagent for studying activated pathways and investigating potential therapeutic targets.</p>APC antibody
<p>The APC antibody is a highly specialized growth factor that plays a crucial role in various biological processes. It has been extensively studied for its ability to interact with alpha-synuclein, a protein associated with neurodegenerative disorders such as Parkinson's disease. This antibody specifically targets and binds to tyrosine residues on alpha-synuclein, inhibiting its aggregation and promoting its clearance from the brain.</p>HCCS Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of HCCS antibody, catalog no. 70R-10236</p>Purezza:Min. 95%PRDX2 antibody
<p>PRDX2 antibody was raised using the middle region of PRDX2 corresponding to a region with amino acids VLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTD</p>NFH antibody
<p>NFH antibody was raised in rabbit using repeated motif, XKSPYK domain [SPEKAKSPEKAKSC] of NFH as the immunogen.</p>Purezza:Min. 95%DPP4 antibody
<p>DPP4 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>Purezza:Min. 95%Ipsalazide
CAS:<p>Ipsalazide is a drug used to treat bowel disease. It is an amide that has been shown to have iontophoretic properties. Ipsalazide inhibits the production of prostaglandins and leukotrienes, which are inflammatory mediators in the intestine. Ipsalazide also reduces pain, cramps, and diarrhea from colitis and other inflammatory bowel diseases. Ipsalazide should not be administered orally because of its high oral toxicity (LD50 = 2 mg/kg).</p>Formula:C16H11N3Na2O6Purezza:Min. 95%Peso molecolare:387.25 g/molZNF474 antibody
<p>ZNF474 antibody was raised in rabbit using the middle region of ZNF474 as the immunogen</p>Purezza:Min. 95%PRD antibody
<p>PRD antibody was raised using the middle region of PRD corresponding to a region with amino acids MTVTAFAAAMHRPFFNGYSTMQDMNSGQGRVNQLGGVFINGRPLPNNIRL</p>NUDT16L1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NUDT16L1 antibody, catalog no. 70R-8788</p>Purezza:Min. 95%eIF4G antibody
<p>The eIF4G antibody is a reactive monoclonal antibody that specifically targets the cysteine-rich protein eIF4G. This protein is activated in response to chemokines and plays a crucial role in various cellular processes related to Life Sciences. The eIF4G antibody has been extensively studied and shown to inhibit transmembrane conductance, human chemokine signaling pathways, and annexin activity. It is a valuable tool for researchers studying the function of eIF4G and its interactions with other proteins such as TNF-α and growth factors. Additionally, this monoclonal antibody can be used in assays involving phosphatase activity or as a cytotoxic agent in certain experimental setups. Trust the eIF4G antibody to provide accurate and reliable results in your research endeavors.</p>Purezza:Min. 95%COL4A5 antibody
<p>The COL4A5 antibody is a monoclonal antibody that specifically targets the collagen type IV alpha 5 chain. It can be used in various applications in Life Sciences research. This antibody has been shown to bind to collagen type IV and inhibit its activity, making it a valuable tool for studying the role of collagen in various cellular processes. Additionally, the COL4A5 antibody has been used in experiments involving creatine kinase activation and family kinase inhibition. Its efficacy has also been demonstrated in electrode-based assays. This antibody is highly specific and shows minimal cross-reactivity with other proteins. It is available as both a monoclonal and polyclonal antibody, allowing researchers to choose the most suitable option for their experiments. The COL4A5 antibody is an essential tool for investigating the functions and mechanisms of collagen type IV and its associated pathways.</p>Purezza:Min. 95%CDK2 antibody
<p>The CDK2 antibody is an essential tool in the field of Life Sciences. It is an antigen that has antiviral properties and can be used to neutralize harmful viruses. This antibody is available in both polyclonal and monoclonal forms, providing researchers with options for their specific needs.</p>TRAF7 antibody
<p>TRAF7 antibody was raised using the N terminal of TRAF7 corresponding to a region with amino acids GPAFSAVTTITKADGTSTYKQHCRTPSSSSTLAYSPRDEEDSMPPISTPR</p>Purezza:Min. 95%AS 252424
CAS:<p>Inhibitor of PI3K? kinase</p>Formula:C14H8FNO4SPurezza:Min. 95%Peso molecolare:305.28 g/molGTPBP2 antibody
<p>GTPBP2 antibody was raised using the N terminal of GTPBP2 corresponding to a region with amino acids GCGGPKGKKKNGRNRGGKANNPPYLPPEAEDGNIEYKLKLVNPSQYRFEH</p>Arsg antibody
<p>Arsg antibody was raised in rabbit using the C terminal of Arsg as the immunogen</p>Purezza:Min. 95%Keratin K18 antibody
<p>Keratin K18 antibody was raised in Guinea Pig using Acidic human keratin K18 as the immunogen.</p>Purezza:Min. 95%CD15 antibody
<p>CD15 antibody is a monoclonal antibody that targets the CD15 antigen, also known as Lewis X. It has been shown to have anti-tumor activity by inhibiting endothelial growth and inducing apoptosis in cancer cells. CD15 antibody can also be used in combination with other antibodies, such as anti-CD33 antibody or tyrosine kinase inhibitors, to enhance its cytotoxic effects. Additionally, CD15 antibody has shown neutralizing activity against vascular endothelial growth factor (VEGF) and tumor necrosis factor-alpha (TNF-α), which are important factors in promoting tumor growth and inflammation. This antibody has demonstrated efficacy in various cancer models, including MCF-7 breast cancer cells and circumsporozoite protein-expressing tumors. Its potential therapeutic applications make CD15 antibody a promising candidate for targeted cancer therapy.</p>TSH antibody (Prediluted for IHC)
<p>Mouse monoclonal TSH antibody (Prediluted for IHC)</p>Purezza:Min. 95%gp91 phox antibody
<p>The gp91 phox antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is commonly used in various applications such as immunohistochemistry, flow cytometry, and Western blotting. This antibody specifically targets the gp91 phox protein, which plays a crucial role in the production of reactive oxygen species (ROS) by neutrophils and other phagocytic cells. By binding to the gp91 phox protein, this antibody can neutralize its activity and prevent ROS production. This makes it an essential tool for studying the role of ROS in various biological processes, including inflammation, oxidative stress, and immune responses. Additionally, this antibody has been validated for use in human serum samples and has shown high affinity and specificity for its target antigen. Whether you are conducting basic research or developing diagnostic assays, the gp91 phox antibody is an invaluable tool that can provide valuable insights into cellular processes and disease mechanisms.</p>PROZ antibody
<p>PROZ antibody was raised in Mouse using a purified recombinant fragment of PROZ expressed in E. coli as the immunogen.</p>DIABLO antibody
<p>DIABLO antibody was raised in rabbit using the C terminal of DIABLO as the immunogen</p>Purezza:Min. 95%IFN α antibody
<p>The IFN alpha antibody is a diagnostic reagent used in the field of Life Sciences. It is a monoclonal antibody that specifically targets interferon alpha, a type of growth factor involved in immune responses. This antibody has been shown to neutralize the activity of interferon alpha, preventing its binding to receptors and subsequent signaling pathways. Additionally, the IFN alpha antibody has been found to enhance reactive oxygen species production and induce lysis in cells expressing interferon alpha. It also plays a role in iron homeostasis by binding to spleen ferritin, a metal-binding protein involved in iron storage and release. The IFN alpha antibody is widely used in research and clinical settings for studying the antiviral properties of interferon alpha and its potential therapeutic applications.</p>Levulinic-d5 acid
CAS:<p>Please enquire for more information about Levulinic-d5 acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C5H8O3Purezza:Min. 95%Peso molecolare:121.15 g/molSurvivin protein (Calmodulin tag)
<p>1-142 amino acids: MADQLTEEQI AEFKEAFSLF DKDGDGTITT KELGTVMRSL GQNPTEAELQ DMINEVDADG NGTIDFPEFL TMMARKMKDT DSEEEIREAF RVFDKDGNGY ISAAELRHVM TNLGEKLTDE EVDEMIREAD IDGDGQVNYE EFVQMMTAKG SHMGAPTLPP AWQPFLKDHR ISTFKNWPFL EGCACTPERM AEAGFIHCPT ENEPDLAQCF FCFKELEGWE PDDDPIEEHK KHSSGCAFLS VKKQFEELTL GEFLKLDRER AKNKIAKETN NKKKEFEETA KKVRRAIEQL AAMD</p>Purezza:Min. 95%EMX1 antibody
<p>EMX1 antibody was raised in rabbit using the middle region of EMX1 as the immunogen</p>Purezza:Min. 95%CD36 protein
<p>The CD36 protein is a growth factor that belongs to the family of diindolylmethane-related proteins and antigens. It is a conjugated protein that plays a crucial role in various biological processes. CD36 is expressed in adipose tissue and has been shown to interact with streptavidin, a cation-binding protein. It is involved in the transport and metabolism of fatty acids, as well as in the neutralizing activity against certain pathogens. CD36 also interacts with the erythropoietin receptor, which is important for red blood cell production. In life sciences research, CD36 is commonly used as a marker for specific cell types or as a target for drug development. Its expression can be detected through techniques such as immunohistochemistry or fluorescence in situ hybridization. CD36 has also been found to play a role in liver microsomes and has been implicated in interferon signaling pathways. Overall, the CD36 protein is an essential component of cellular processes and holds significant</p>Purezza:Min. 95%Influenza A H1N1 protein (Beijing)
<p>Purified native Influenza A H1N1 protein (Beijing)</p>Purezza:Min. 95%ZNF12 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF12 antibody, catalog no. 20R-1099</p>Purezza:Min. 95%M-CSF protein
<p>Region of M-CSF protein corresponding to amino acids MEEVSEYCSH MIGSGHLQSL QRLIDSQMET SCQITFEFVD QEQLKDPVCY LKKAFLLVQD IMEDTMRFRD NTPNAIAIVQ LQELSLRLKS CFTKDYEEHD KACVRTFYET PLQLLEKVKN VFNETKNLLD KDWNIFSKNC NNSFAECSSQ GHERQSEGS.</p>Purezza:Min. 95%PSMA6 antibody
<p>PSMA6 antibody was raised using a synthetic peptide corresponding to a region with amino acids EYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITEN</p>RPUSD2 antibody
<p>RPUSD2 antibody was raised using the N terminal of RPUSD2 corresponding to a region with amino acids LKDNDFLRNTVHRHEPPVTAEPIRLLAENEDVVVVDKPSSIPVHPCGRFR</p>ZNF680 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF680 antibody, catalog no. 70R-9010</p>Purezza:Min. 95%
