Prodotti biochimici e reagenti

<p>Purified Rabbit polyclonal OR8H2 antibody</p>

<p>Syk Inhibitor is a small molecule compound designed to inhibit the activity of spleen tyrosine kinase (Syk), which is derived through advanced chemical synthesis from a variety of organic substrates. With its mode of action as a kinase inhibitor, Syk Inhibitor functions by specifically binding to the ATP-binding site of the Syk enzyme. This binding effectively blocks the phosphorylation processes necessary for signal transduction pathways that are critical in immune cell activation and function.</p>

<p>Rabbit Polyclonal eNOS antibody (Ser615)</p>

<p>NSC16168 is a molecule that has been shown to inhibit the influenza virus neuraminidase. It binds to the monoadducts of the viral neuraminidase and cisplatin, preventing them from binding to their cellular targets. This prevents viral replication and may also inhibit the dna methylation process in mammalian cells. NSC16168 can be used as a cancer therapy for cancer cells that express influenza virus neuraminidase on their surface.</p>

<p>Thiocarbamyl nitro blue tetrazolium (TNT) is a stain that is used to identify the location of sarcoplasmic proteins in redox potentials. TNT is also used to identify the localization of proteins in isolated hearts, as well as during cancer research. The reaction products are phosphatase-based and can be detected visually. TNT can be used for functional assays that determine the mitochondrial activity of fatty acids and nitrosamines. TNT stains cellular organelles such as mitochondria, lysosomes, peroxisomes, and Golgi bodies.</p>

<p>MAL-dPEG®4-Lys(-5(6)-Carboxyfluorescein)-NH-m-dPEG®24 is a PEG compound containing a fluorescein dye used for tagging biomolecules, and serving as fluorescent probe for bioimaging applications.</p>

<p>The INSR antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets the insulin receptor (INSR) protein, which plays a crucial role in cellular signaling and glucose metabolism. This antibody can be used to study various aspects of INSR function, including its interaction with other proteins such as telomerase, glucagon, β-catenin, and collagen.</p>

<p>JE MCP1 antibody was raised in rabbit using highly pure recombinant JE(MCP-1) as the immunogen.</p>

<p>DBCO-dPEG®12-TFP Ester is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. DBCO-dPEG®12-TFP Ester is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>

<p>Mouse monoclonal MRPS25 antibody</p>

<p>Rabbit polyclonal MPO antibody (Prediluted for IHC)</p>

<p>Rabbit anti-cat IgG (HRP) was raised in rabbit using feline IgG F(ab')2 fragment as the immunogen.</p>

<p>MRPL48 antibody was raised in Rabbit using Human MRPL48 as the immunogen</p>

<p>Chymotrypsinogen B1 antibody was raised using the middle region of CTRB1 corresponding to a region with amino acids VTAAHCGVRTSDVVVAGEFDQGSDEENIQVLKIAKVFKNPKFSILTVNND</p>

<p>The BHMT antibody is a highly specialized antibody used in Life Sciences research. It targets the BHMT protein, which plays a crucial role in various biological processes. The BHMT antibody has been shown to have neutralizing properties against the fibronectin, cholinergic, insulin, and collagen pathways. This makes it an essential tool for studying the interactions between these proteins and their associated functions.</p>

<p>PINK1 protein is a key player in cellular processes and has been studied extensively in the field of Life Sciences. It is involved in various functions, including the regulation of mesenchymal stem cells and collagen production. PINK1 protein has been utilized for ultrasensitive detection in human serum using electrochemical impedance spectroscopy, making it a valuable tool for diagnostic purposes. Additionally, recombinant proteins and monoclonal antibodies targeting PINK1 have been developed for research applications. These antibodies have shown neutralizing properties against reactive forms of PINK1, further highlighting their potential therapeutic significance. With its unique characteristics and applications, PINK1 protein continues to contribute to advancements in the field of Life Sciences.</p>

<p>Rabbit polyclonal RAB33A antibody</p>

<p>Abcc2 antibody was raised in rabbit using the middle region of Abcc2 as the immunogen</p>

<p>IGFBP1 antibody was raised in Rabbit using Human IGFBP1 as the immunogen</p>

<p>Affinity purified Rabbit polyclonal gamma Actin antibody</p>

<p>NEIL3 antibody was raised in mouse using recombinant Human Nei Endonuclease Viii-Like 3 (E. Coli)</p>

<p>Rabbit polyclonal TUBGCP3 antibody</p>

<p>PTK2B antibody was raised using the C terminal of PTK2B corresponding to a region with amino acids KSPLTPEKEVGYLEFTGPPQKPPRLGAQSIQPTANLDRTDDLVYLNVMEL</p>

<p>Rabbit polyclonal TRIM28 antibody (biotin)</p>

<p>Purified Polyclonal DFF45 antibody</p>

<p>Mouse monoclonal TUBA8 antibody</p>

<p>PRMT2 antibody was raised using the N terminal of PRMT2 corresponding to a region with amino acids ERAGCCGYIPANHVGKHVDEYDPEDTWQDEEYFGSYGTLKLHLEMLADQP</p>

<p>Mouse anti Rat IgM secondary antibody (HRP)</p>

<p>Mouse monoclonal PRKY antibody</p>

<p>Purified recombinant Glypican 6 protein (His tag)</p>

<p>Purified recombinant GREM2 protein (His tag)</p>

<p>MAL-dPEG®36-TFP Ester is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. MAL-dPEG®36-TFP Ester is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>

<p>Papaverine is a plant alkaloid that has been shown to be effective as an analgesic and anti-inflammatory agent. It is used in the treatment of chronic pain and inflammation, but its mechanism of action is not well understood. Papaverine has been shown to inhibit the production of growth factors, such as platelet-derived growth factor (PDGF), by cells. Papaverine also has effects on the immune system and may act through toll-like receptor 4 (TLR4) to inhibit tumor cell proliferation. The effective dose for papaverine ranges from 1 mg to 10 mg per day, depending on the condition being treated. This drug can be administered orally or intravenously as a pharmaceutical preparation.</p>

<p>CTSF antibody was raised in Rabbit using Human CTSF as the immunogen</p>

<p>Rabbit polyclonal IRS1 antibody (Ser323)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GALNT14 antibody, catalog no. 70R-7437</p>

<p>SLC22A11 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAFSKLLEQAGGVGLFQTLQVLTFILPCLMIPSQMLLENFSAAIPGHRCW</p>

<p>IL8RB antibody was raised using the N terminal of IL8RB corresponding to a region with amino acids MEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCEPESLEINKYF</p>

<p>The EP4 antibody is a highly specialized product in the field of Life Sciences. It is an antibody that targets and binds to the EP4 receptor, which plays a crucial role in various biological processes. This monoclonal antibody has been extensively studied and proven to be effective in blocking the activity of the EP4 receptor.</p>

<p>The USP15 antibody is a highly specialized monoclonal antibody used in various life sciences applications. It is derived from a benzazepine compound and has been extensively studied for its cytotoxic properties. This antibody specifically targets and binds to USP15, a protein involved in the regulation of various cellular processes.</p>

<p>Akt, also known as Protein Kinase B (PKB), is an essential cellular protein that governs vital processes such as cell growth, survival, metabolism, and proliferation through the PI3K/Akt pathway, which is activated by hormones like insulin. Upon activation, Akt translocates to the cell membrane, where it undergoes full activation via phosphorylation by kinases like PDK1. This activation allows Akt to prevent apoptosis, promote cell growth via pathways like mTOR, and boost glucose metabolism, crucial for insulin responsiveness. Dysregulation in the Akt pathway is frequently associated with diseases like cancer and diabetes; mutations in pathway components such as PI3K, PTEN, or Akt itself can result in enhanced cell survival, uncontrolled growth, and resistance to treatment in cancer, as well as impaired glucose uptake in diabetes. Given its central role in these processes, Akt is a primary target in therapeutic research focused on regulating growth and metabolism.</p>

<p>FCN1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GSQLGEFWLGNDNIHALTAQGSSELRVDLVDFEGNHQFAKYKSFKVADEA</p>

<p>Morphine-3 antibody was raised in mouse using morphine-3 as the immunogen.</p>

<p>Epithelium specific antigen antibody was raised in Mouse using HT-29 colon carcinoma cell line as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ITGB5 antibody, catalog no. 70R-6842</p>

<p>The Kv1.5 antibody is a growth factor that plays a crucial role in multidrug resistance and immunoassays. It is a polyclonal antibody that specifically targets the Kv1.5 protein kinase, which is involved in various cellular processes. This antibody can be used in research and diagnostic applications to detect and quantify the expression of Kv1.5 in different samples.</p>

<p>IGSF8 antibody was raised in Rabbit using Human IGSF8 as the immunogen</p>

<p>The G3BP1 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It specifically targets and binds to the G3BP1 protein, which plays a crucial role in various cellular processes such as collagen synthesis, antigen presentation, and growth factor signaling. This antibody has been extensively tested and validated for its high affinity and specificity towards G3BP1.</p>

<p>Purified Rabbit polyclonal TIFIA antibody (Ser649)</p>

<p>CKMM antibody was raised in mouse using CKMM purified from human smooth muscle as the immunogen.</p>

<p>Sheep polyclonal Norescitalopram antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GCS1 antibody, catalog no. 70R-6629</p>

<p>Cytokeratin 8 antibody was raised using the middle region of KRT8 corresponding to a region with amino acids QSLAGKHGDDLRRTKTEISEMNRNISRLQAEIEGLKGQRASLEAAIADAE</p>

<p>STOM antibody is a neutralizing antibody that belongs to the family of kinase inhibitors. It is widely used in the field of Life Sciences for various applications. This polyclonal antibody specifically targets STOM (Stomatin) molecules, which are involved in the regulation of ion channels and membrane transporters. STOM antibody has been shown to be effective in neutralizing the activity of STOM, thereby inhibiting its function. This antibody can be used in research studies involving mesenchymal stem cells, as well as in experiments investigating the role of growth factors such as epidermal growth factor. The high specificity and affinity of this antibody make it an ideal tool for studying the functions and signaling pathways associated with STOM. It is available as both monoclonal and polyclonal antibodies, ensuring flexibility in experimental design. The formulation includes excipients to ensure stability and long shelf life.</p>

<p>ZNF419A antibody was raised in rabbit using the C terminal of ZNF419A as the immunogen</p>

<p>Chlamydia trachomatis antibody (HRP) was raised in goat using L2 and other serovar groups as the immunogen.</p>

<p>Rabbit polyclonal TSHZ1 antibody</p>

<p>SAA4 antibody was raised using the middle region of SAA4 corresponding to a region with amino acids AAKLISRSRVYLQGLIDYYLFGNSSTVLEDSKSNEKAEEWGRSGKDPDRF</p>

<p>NDUFB1 antibody was raised in Rabbit using Human NDUFB1 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GALNT4 antibody, catalog no. 70R-7245</p>

<p>ERCC5 antibody was raised using the N terminal of ERCC5 corresponding to a region with amino acids NPQAIDIESEDFSSLPPEVKHEILTDMKEFTKRRRTLFEAMPEESDDFSQ</p>

<p>Rabbit polyclonal TMF1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KIAA1191 antibody, catalog no. 70R-4315</p>

<p>KRR1 antibody was raised using the C terminal of KRR1 corresponding to a region with amino acids KANQKKRQKMEAIKAKQAEAISKRQEERNKAFIPPKEKPIVKPKEASTET</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of UPF3B antibody, catalog no. 70R-4711</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CSNK1A1L antibody, catalog no. 70R-9204</p>

<p>PRKRA antibody was raised using the middle region of PRKRA corresponding to a region with amino acids RLPEYTLSQEGGPAHKREYTTICRLESFMETGKGASKKQAKRNAAEKFLA</p>

<p>The NSE antibody is a monoclonal antibody that is used in various Life Sciences applications. It specifically targets tyrosine residues and can be used in immunohistochemistry, immunoblotting, and other protein detection assays. The NSE antibody has been shown to react with coagulation factors, TNF-α, and various monoclonal antibodies. It is also effective in detecting antiphospholipid antibodies and has been used in research related to protein kinases and collagen. Additionally, the NSE antibody can be used for neutralizing assays. With its high specificity and versatility, this antibody is a valuable tool for researchers in the Life Sciences field.</p>

<p>Purified Human IgG Fab'2 for use as a control or blocking reagent</p>

<p>Region of Follistatin protein corresponding to amino acids GNCWLRQAKN GRCQVLYKTE LSKEECCSTG RLSTSWTEED VNDNTLFKWM IFNGGAPNCI PCKETCENVD CGPGKKCRMN KKNKPRCVCA PDCSNITWKG PVCGLDGKTY RNECALLKAR CKEQPELEVQ YQGRCKKTCR DVFCPGSSTC VVDQTNNAYC VTCNRICPEP ASSEQYLCGN DGVTYSSACH LRKATCLLGR SIGLAYEGKC IKAKSCEDIQ CTGGKKCLWD FKVGRGRCSL CDELCPDSKS DEPVCASDNA TYASECAMKE AACSSGVLLE VKHSGSCN.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TRIB1 antibody, catalog no. 70R-9178</p>

<p>Auh antibody was raised in rabbit using the N terminal of Auh as the immunogen</p>

<p>12:0 Lyso NBD PC is a fluorescent lipid probe, which is an analog of lysophosphatidylcholine. This synthetic product is derived from phospholipids modified with a NBD (7-nitro-2-1,3-benzoxadiazol-4-yl) fluorophore. Its primary manner of action involves integration into cellular membranes, where it enhances the visualization of lipid domains and membrane trafficking through fluorescence microscopy or flow cytometry.</p>

<p>Mitoebselen-2 is a peptide that is an activator of ion channels. It has been shown to inhibit the activity of protein interactions by binding to receptors and ligands. Mitoebselen-2 has been used in research as a tool for studying cell biology and pharmacology, as well as antibody production. Mitoebselen-2 has shown no adverse effects on mammals and can be used without restriction.</p>

<p>Rabbit polyclonal PDIA1 antibody</p>

<p>2,2,6-Trimethyl-4-(4-nitrobenzo(1,2,5)oxadiazol-7-ylamino)-6-pentylpiperidine-1-oxyl is a research tool that belongs to the group of activator ligands. It is used as an activator for ion channels such as nicotinic acetylcholine receptors and voltage gated potassium channels. 2,2,6-Trimethyl-4-(4-nitrobenzo(1,2,5)oxadiazol-7-ylamino)-6-pentylpiperidine-1-oxyl has been shown to bind to the extracellular domain of the receptor and induce conformational changes in the protein. The binding site has also been identified as being within a region of the receptor involved in protein interactions. This compound may also be used as a reagent in pharmacology or as a research tool in</p>

<p>Vincristine is an anticancer agent that belongs to the class of chemotherapeutic agents. It has been used in the treatment of retinoblastoma, Hodgkin's disease, and other cancers. Vincristine-d3 sulfate is a radiochemical precursor of vincristine that can be used for the determination of this drug in biological matrices. The sensitivity of this compound is high and it has no matrix effect. The linear range for vincristine-d3 sulfate is between 1-10 µg/mL, which makes it suitable for use with sample volumes less than 10 mL. This compound can also be analyzed by liquid chromatography coupled with tandem mass spectrometry (LC-MS/MS).</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections. This active compound exhibits bactericidal activity by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Extensive research has shown its potential through various techniques such as patch-clamp technique on human erythrocytes. Metabolically, it undergoes hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>Purified recombinant FOPNL protein (His tag)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLC11A2 antibody, catalog no. 70R-6786</p>

<p>Mouse monoclonal NEUROG1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MYBPC2 antibody, catalog no. 70R-6055</p>

<p>Rabbit Polyclonal Akt2 antibody (Ser474)</p>

<p>Rabbit polyclonal p53 antibody (Thr387)</p>

<p>NDUFA5 antibody was raised in Rabbit using Human NDUFA5 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PKLR antibody, catalog no. 70R-1230</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CA2 antibody, catalog no. 70R-9978</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of OR5T2 antibody, catalog no. 70R-6531</p>

<p>Vimentin antibody was raised using the C terminal of VIM corresponding to a region with amino acids SSLNLRETNLDSLPLVDTHSKRTLLIKTVETRDGQVINETSQHHDDLE</p>

<p>1-277 amino acids: MSSGIHVALV TGGNKGIGLA IVRDLCRLFS GDVVLTARDV TRGQAAVQQL QAEGLSPRFH QLDIDDLQSI RALRDFLRKE YGGLDVLVNN AGIAFKVADP TPFHIQAEVT MKTNFFGTRD VCTELLPLIK PQGRVVNVSS IMSVRALKSC SPELQQKFRS ETITEEELVG LMNKFVEDTK KGVHQKEGWP SSAYGVTKIG VTVLSRIHAR KLSEQRKGDK ILLNACCPGW VRTDMAGPKA TKSPEEGAET PVYLALLPPD AEGPHGQFVS EKRVEQW</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LMNB1 antibody, catalog no. 70R-2064</p>

<p>The SUCLG2 antibody is a highly specialized monoclonal antibody that specifically binds to SUCLG2, a protein involved in cellular metabolism. This antibody can be used in various research applications, including immunohistochemistry and protein-protein interaction studies. It has been shown to effectively detect and quantify SUCLG2 levels in different cell types and tissues. The binding of the SUCLG2 antibody to its target protein can lead to downstream effects such as interference with chemokine signaling pathways or cytotoxic activity. Additionally, this antibody can be used in antibody-drug conjugate strategies, where it is conjugated to a cytotoxic compound for targeted therapy. Overall, the SUCLG2 antibody is a valuable tool for researchers in the Life Sciences field who are studying cellular metabolism and its implications in various diseases and conditions.</p>

<p>The RGS4 antibody is a monoclonal antibody that specifically targets the human serum racemase. It is commonly used in Life Sciences research as an inhibitor of activated racemase. This cytotoxic antibody is produced by a hybridoma cell line and has been extensively studied for its potential therapeutic applications. The RGS4 antibody can be immobilized on an electrode or used in conjunction with other antibodies, such as anti-CD33 antibody, for various experimental purposes. Its high specificity and affinity make it a valuable tool in the field of Antibodies research.</p>

<p>The CD51 antibody is a powerful tool for researchers in the field of life sciences. It is a monoclonal antibody that specifically targets and binds to CD51, a protein found on mesenchymal stem cells. This antibody has various applications, including as a cytokine inhibitor and growth factor binding agent.</p>

<p>COPZ1 antibody was raised in Rabbit using Human COPZ1 as the immunogen</p>

<p>Rabbit polyclonal YARS antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of STAU1 antibody, catalog no. 70R-5010</p>

<p>Rabbit polyclonal CDKL2 antibody</p>

<p>STAT3 antibody was raised in mouse using recombinant Signal Transducer And Activator Of Transcription 3 (Acute-Phase Response Factor)</p>

<p>The PARP antibody is a monoclonal antibody that belongs to the class of antibodies used in Life Sciences. It specifically targets and binds to poly(ADP-ribose) polymerase (PARP), an enzyme involved in DNA repair processes. This antibody has been shown to be effective in neutralizing PARP activity, making it a valuable tool for studying the role of PARP in various cellular processes.</p>