Prodotti biochimici e reagenti

<p>Mouse monoclonal PRKAA1 antibody</p>

<p>Rabbit polyclonal RFWD3 antibody</p>

<p>Rat monoclonal CD31 antibody (biotin)</p>

<p>Rabbit polyclonal NOC2 antibody</p>

<p>ATXN7 antibody was raised in rabbit using the middle region of ATXN7 as the immunogen</p>

<p>Binapacryl is a chemical compound classified as an acaricide and fungicide. It is a synthetic product derived from the chemical industry, specifically formulated through complex organic synthesis processes. The mode of action of Binapacryl involves the uncoupling of oxidative phosphorylation in mitochondria, disrupting the energy production within cells, which ultimately leads to the mortality of targeted pests.</p>

<p>The ZIC4 antibody is a highly specialized medicament that targets specific autoantibodies in the body. These autoantibodies are associated with glycosylation and fatty acid modifications, which can lead to various health issues. The ZIC4 antibody works by neutralizing these autoantibodies, thereby reducing their harmful effects on the body.</p>

<p>Mouse monoclonal anti human GSR antibody</p>

<p>The CA 19-9 antibody is a monoclonal antibody that specifically targets the CA 19-9 antigen. This antigen is commonly found in various types of cancer, particularly pancreatic, colorectal, and gastric cancers. The CA 19-9 antibody has been extensively studied and has shown promising results in both diagnostic and therapeutic applications.</p>

<p>LYVE1 antibody was raised in mouse using recombinant human LYVE-1 (25-235 aa) purified from E. coli as the immunogen.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is known for its bactericidal activity against tuberculosis infection and is highly effective in inhibiting bacterial growth. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication. The active form of this drug has been extensively studied using advanced techniques like the patch-clamp technique on human erythrocytes. It undergoes various metabolic transformations, including hydrolysis, oxidation, reduction, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains, inhibiting their cell growth in culture.</p>

<p>Mouse monoclonal CHCHD5 antibody</p>

<p>Phencyclidine antibody is a highly specialized antibody used in Life Sciences research. It is designed to specifically target and bind to the phencyclidine molecule, which is a psychoactive drug. This antibody can be used for various assays and experiments to detect the presence of phencyclidine in samples such as human serum or adipose tissue. The use of polyclonal and monoclonal antibodies ensures high specificity and sensitivity in detecting this target molecule. Phencyclidine antibody has also been studied for its potential therapeutic applications, such as in the treatment of thrombocytopenia or as inhibitors of urokinase plasminogen activator. Additionally, it has shown promising results in targeting other molecules like mesothelin or icos antibodies. Its cytotoxic properties make it a valuable tool in research aimed at understanding the effects of phencyclidine and developing treatments for related conditions.</p>

<p>ENTPD7 antibody was raised using the C terminal of ENTPD7 corresponding to a region with amino acids EHRLKYQCFKSAWMYQVLHEGFHFPYDYPNLRTAQLVYDREVQWTLGAIL</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DCBLD1 antibody, catalog no. 70R-6113</p>

<p>ZNF791 antibody was raised in rabbit using the middle region of ZNF791 as the immunogen</p>

<p>The RAGE Blocking Peptide is a highly effective cytotoxic peptide that targets the nuclear receptor RAGE (Receptor for Advanced Glycation Endproducts). It works by blocking the interaction between RAGE and its ligands, which include growth factors and activated antibodies such as anti-HER2 antibody trastuzumab. This blocking action inhibits the downstream signaling pathways associated with RAGE activation, leading to reduced cell proliferation and increased cell death.</p>

<p>FAM54A antibody was raised using the middle region of FAM54A corresponding to a region with amino acids NKTNYSHHSKSQRNKDIPNMLDVLKDMNKVKLRAIERSPGGRPIHKRKRQ</p>

<p>The p300 antibody is a neutralizing agent that acts as an anticoagulant by targeting autoantibodies in human serum. This monoclonal antibody specifically binds to growth factors, such as reactive endothelial growth factor, inhibiting their activity. The p300 antibody can also be conjugated with streptavidin for use in various applications, including the detection of antiphospholipid antibodies and basic proteins. Additionally, polyclonal antibodies and peptide agents can be developed using the p300 antibody for research purposes. With its versatile properties and targeted action, the p300 antibody is a valuable tool in biomedical research and diagnostics.</p>

<p>KIRREL3 antibody was raised in Rabbit using Human KIRREL3 as the immunogen</p>

<p>CD105 antibody was raised in rabbit using recombinant mouse soluble CD105/Endoglin as the immunogen.</p>

<p>The FAM84B antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets FAM84B, a protein involved in various cellular processes. This antibody has been extensively studied and proven to be highly effective in detecting and quantifying FAM84B levels in biological samples.</p>

<p>The MFAP4 antibody is a growth factor that targets epidermal growth factor and belongs to the class of monoclonal antibodies. It has cytotoxic properties and can induce lysis of targeted cells. This antibody specifically binds to the MFAP4 protein, inhibiting its function and preventing collagen synthesis. Additionally, it acts as a neutralizing agent against TGF-beta, a potent cytokine involved in cell proliferation and differentiation. The MFAP4 antibody has been shown to be effective in combination with other therapies such as trastuzumab, an antibody used in the treatment of breast cancer. Furthermore, it has potential applications in the treatment of infections caused by Mycoplasma genitalium, a sexually transmitted bacterium.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug from the rifamycins class. It is specifically designed to combat tuberculosis infection by targeting active compounds and exhibiting bactericidal activity. The effectiveness of this drug has been demonstrated through transcription-quantitative polymerase chain techniques, as well as patch-clamp techniques on human erythrocytes. It undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it binds to markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>Mouse monoclonal LDLRAP1 antibody</p>

<p>KLRF1 antibody was raised using the middle region of KLRF1 corresponding to a region with amino acids QKGSCSNATQYEDTGDLKVNNGTRRNISNKDLCASRSADQTVLCQSEWLK</p>

<p>NDUFV3 antibody was raised using a synthetic peptide corresponding to a region with amino acids PAPVPAEPFDNTTYKNLQHHDYSTYTFLDLNLELSKFRMPQPSSGRESPR</p>

<p>RBBP7 antibody was raised using the middle region of RBBP7 corresponding to a region with amino acids HWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDGPPELLFIHGGH</p>

<p>Mouse monoclonal ARHGAP25 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF258 antibody, catalog no. 70R-8056</p>

<p>The EEF2 antibody is a highly specific monoclonal antibody that is widely used in life sciences research. It binds to and detects the eukaryotic elongation factor 2 (EEF2) protein, which plays a crucial role in protein synthesis. This antibody has been extensively validated for various applications, including immunohistochemistry, western blotting, and flow cytometry.</p>

<p>Mouse monoclonal CD90.1 antibody</p>

<p>PSA antibody was raised in mouse using human PSA from seminal plasma as the immunogen.</p>

<p>The AK1 antibody is a highly specific monoclonal antibody that targets the AK1 cell antigen. It has been extensively studied in the field of Life Sciences and has shown promising results in various applications. The AK1 antibody binds to transferrin, a glycoprotein involved in iron transport, and hemagglutinin, a protein found on the surface of red blood cells. This binding leads to the inhibition of exocytosis, preventing the release of antibodies and cytotoxic molecules. Additionally, the AK1 antibody has been shown to have an impact on interleukin signaling pathways, particularly interleukin-6, which plays a crucial role in immune responses and inflammation. Its unique glycosylation pattern enhances its stability and prolongs its half-life in circulation. The AK1 antibody holds great potential as a therapeutic agent in various disease conditions and is widely used in research laboratories for its exceptional specificity and efficacy.</p>

<p>Mouse monoclonal TUBA3E antibody</p>

<p>Rabbit polyclonal RNASE11 antibody</p>

<p>Antiparkinsonian</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LRRC8B antibody, catalog no. 70R-6538</p>

<p>The TRPV3 antibody is a highly specialized antibody that targets the cation channel TRPV3. This antibody has been extensively studied and proven to be effective in various applications. It can be used as a colloidal or cross-linking agent in experiments involving TNF-α activation. The TRPV3 antibody is available in both monoclonal and polyclonal forms, providing researchers with options for their specific needs.</p>

<p>TOX antibody was raised in rabbit using the N terminal of TOX as the immunogen</p>

<p>KCNMA1 antibody was raised using the middle region of KCNMA1 corresponding to a region with amino acids CFGIYRLRDAHLSTPSQCTKRYVITNPPYEFELVPTDLIFCLMQFDHNAG</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FAM55D antibody, catalog no. 70R-1827</p>

<p>Purified Polyclonal BTF3L4 antibody</p>

<p>Rabbit polyclonal SS18L2 antibody</p>

<p>Giredestrant is a synthetic peptide that can be used as a research tool in pharmacology and cell biology. Giredestrant binds to the acetylcholine receptor, blocking its ability to respond to acetylcholine. Giredestrant also inhibits protein interactions with ion channels and ligand-gated ion channels, which are important for the transmission of nerve impulses. The high purity of this reagent makes it suitable for use in cell biology research.</p>

<p>TBC1D10C antibody was raised using the N terminal of TBC1D10C corresponding to a region with amino acids MAQALGEDLVQPPELQDDSSSLGSDSELSGPGPYRQADRYGFIGGSSAEP</p>

<p>ADRA1B antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>ALOX15B antibody was raised using the N terminal of ALOX15B corresponding to a region with amino acids MAEFRVRVSTGEAFGAGTWDKVSVSIVGTRGESPPLPLDNLGKEFTAGAE</p>

<p>Purified recombinant Human ADPRHL2 protein (His tag)</p>

<p>GHRHR antibody was raised using the C terminal of GHRHR corresponding to a region with amino acids YWWIIKGPIVLSVGVNFGLFLNIIRILVRKLEPAQGSLHTQSQYWYCVFV</p>

<p>Catalase antibody was raised using the middle region of CAT corresponding to a region with amino acids LKDAQIFIQKKAVKNFTEVHPDYGSHIQALLDKYNAEKPKNAIHTFVQSG</p>

<p>The SH3BP5 antibody is a powerful tool used in life sciences research. It is a monoclonal antibody that specifically targets and binds to SH3BP5, an important protein involved in various cellular processes. This antibody has been extensively studied for its role in interferon signaling and apoptosis induction.</p>

<p>Purified Polyclonal FR gamma antibody</p>

<p>Rabbit polyclonal TrkB antibody (Tyr706+Tyr707)</p>

<p>The LTA4H antibody is a highly effective test substance used in various applications such as electrophoresis, erythropoietin analysis, and phalloidin staining. This antibody specifically targets LTA4H, an enzyme involved in the synthesis of leukotriene B4 (LTB4), which plays a crucial role in inflammation and immune response. The LTA4H antibody is widely used in the field of Life Sciences for research purposes, including the study of actin filaments, growth factors, chemokines, and monoclonal antibodies. It is also utilized as a neutralizing agent or medicament for therapeutic applications. With its high specificity and reliability, the LTA4H antibody is an essential tool for scientists and researchers in their pursuit of understanding complex biological processes.</p>

<p>Mouse monoclonal LDLRAP1 antibody</p>

<p>The HSP90AB1 antibody is a monoclonal antibody used in Life Sciences research. It is specifically designed to target and bind to the HSP90AB1 protein, which plays a crucial role in various cellular processes. This antibody has been extensively studied and validated for its high specificity and sensitivity.</p>

<p>SF4 antibody was raised in rabbit using the C terminal of SF4 as the immunogen</p>

<p>MEMO1 antibody was raised using the middle region of MEMO1 corresponding to a region with amino acids AMESHKDEFTIIPVLVGALSESKEQEFGKLFSKYLADPSNLFVVSSDFCH</p>

<p>ADAM19 antibody was raised using a synthetic peptide corresponding to a region with amino acids GRELILDLEKNEQLFAPSYTETHYTSSGNPQTTTRKLEDHCFYHGTVRET</p>

<p>RPA4 antibody was raised using the middle region of RPA4 corresponding to a region with amino acids VPVSPSEVNDAGDNDESHRNFIQDEVLRLIHECPHQEGKSIHELRAQLCD</p>

<p>Purified native Adenovirus protein (Mouse)</p>

<p>Rabbit polyclonal Galectin 3 antibody (Biotin)</p>

<p>Mouse monoclonal ASNA1 antibody</p>

<p>Rat monoclonal CD144 antibody (PE)</p>

<p>The RBBP4 antibody is a polyclonal antibody used in Life Sciences research. It specifically targets the RBBP4 protein, which plays a crucial role in various cellular processes. This antibody has been shown to bind to albumin and activate it, leading to changes in human serum composition. Additionally, it has been found to interact with alpha-synuclein, a protein associated with neurodegenerative diseases.</p>

<p>The IL15Ra antibody is a highly specialized antibody used in Life Sciences research. It targets the IL-15 receptor alpha chain, which plays a crucial role in immune response and cell proliferation. This antibody is commonly used in studies involving colony-stimulating factors and macrophage colony-stimulating factors.</p>

<p>Purified recombinant DENV protein (His tag)</p>

<p>ACADSB antibody was raised using the middle region of ACADSB corresponding to a region with amino acids GLRASSTCPLTFENVKVPEANILGQIGHGYKYAIGSLNEGRIGIAAQMLG</p>

<p>PROTAC cIAP1 degrader-4 is a peptide inhibitor of the protein IAP1. It is a recombinant fusion protein consisting of the C terminus of human caspase-recruitment domain (CARD) with the N terminus of mouse IgG2a Fc region. The CARD domain binds to and inhibits the activity of IAP1, which is an inhibitor of apoptosis. This product can be used as a research tool and antibody probe for studying protein interactions, ligands, receptors, ion channels, and other proteins in cell biology research.</p>

<p>LCMV antibody was raised in mouse using LCMV isolated from human HeLa cells as the immunogen.</p>

<p>Mouse monoclonal ADI1 antibody</p>

<p>The E Tag antibody is a highly specific monoclonal antibody that is used for hybridization experiments. It binds to the E Tag sequence, which is commonly attached to proteins of interest for detection and purification purposes. The E Tag antibody has a high affinity for the E Tag sequence, allowing for sensitive and accurate detection of tagged proteins in various applications. This antibody can be used in immunoprecipitation, western blotting, flow cytometry, and other techniques to study protein-protein interactions, protein localization, and protein expression levels. The E Tag antibody is produced using advanced monoclonal antibody technology and is purified to ensure high specificity and low background signal. With its exceptional performance and reliability, the E Tag antibody is an essential tool for researchers working in molecular biology, cell biology, and biochemistry.</p>

<p>MRPL28 antibody was raised using the middle region of MRPL28 corresponding to a region with amino acids EDPERRAAIYDKYKEFAIPEEEAEWVGLTLEEAIEKQRLLEEKDPVPLFK</p>

<p>Purified Rabbit polyclonal PNMA2 antibody</p>

<p>The Influenza B antibody is a monoclonal antibody that has been developed to specifically target and neutralize the Influenza B virus. This antibody is a powerful tool in the fight against influenza, as it can recognize and bind to specific proteins on the surface of the virus, preventing it from infecting host cells.</p>

<p>Karyopherin Alpha 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NMEMAPGGVITSDMIEMIFSKSPEQQLSATQKFRKLLSKEPNPPIDEVIS</p>

<p>Recombinant Human PIH1D2 protein</p>

<p>WT1 antibody was raised in rabbit using the N terminal of WT1 as the immunogen</p>

<p>Rabbit polyclonal Myc antibody (Ser62)</p>

<p>Purified Polyclonal RAC2 antibody</p>

<p>HOXB5 antibody was raised in mouse using recombinant Human Homeo Box B5</p>

<p>Rabbit polyclonal SHROOM1 antibody</p>

<p>Peptide YY antibody was raised in guinea pig using synthetic porcine peptide TT as the immunogen.</p>

<p>RPS13 antibody was raised using the middle region of RPS13 corresponding to a region with amino acids ILRILKSKGLAPDLPEDLYHLIKKAVAVRKHLERNRKDKDAKFRLILIES</p>

<p>hCG beta antibody (HRP) was raised in mouse using hCG beta as the immunogen.</p>

<p>Mouse monoclonal CHCHD5 antibody</p>

<p>PSMD8 antibody was raised using a synthetic peptide corresponding to a region with amino acids DYAKKRGWVLGPNNYYSFASQQQKPEDTTIPSTELAKQVIEYARQLEMIV</p>

<p>Mouse Monoclonal KRT20 antibody</p>

<p>Inhibitor of CDK2/CDK9 kinases</p>

<p>Rat monoclonal IgM antibody (PE)</p>

<p>The DUSP1 antibody is an antigen binding molecule used in Life Sciences research. It is commonly used to study the biological effects of epidermal growth factor (EGF), parathyroid hormone-related peptide (PTHrP), and hepatocyte growth factor (HGF). The DUSP1 antibody has been shown to inhibit cell proliferation and promote apoptosis in various cell types. Additionally, it has been used to measure microvessel density in isolated retinal tissue and to study the role of taurine in human serum. The DUSP1 antibody is available as both a polyclonal antibody and a mouse monoclonal antibody, providing researchers with options for their specific experimental needs.</p>

<p>Rabbit polyclonal OR13C3 antibody</p>

<p>Purified native Porcine Lactate Dehydrogenase protein</p>

<p>The VAV1 antibody is a highly specialized product in the field of Life Sciences. It is designed to target specific antigens, such as tissue transglutaminase and brain natriuretic peptide, in human serum. This monoclonal antibody has been extensively tested and proven to have high affinity and specificity for its target antigens.</p>

<p>BRS3 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Rabbit polyclonal AurB antibody (Thr232)</p>

<p>The RAB3D antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is specifically designed to target and bind to the alpha-fetoprotein (AFP) in human serum. Autoantibodies against AFP have been shown to be associated with various diseases, including liver cancer and hepatocellular carcinoma.</p>

<p>Mouse monoclonal LDHB antibody</p>

<p>The Ofloxacin monoclonal antibody is a powerful tool in the field of Life Sciences. It has the unique ability to neutralize interferon, a key player in the immune response. This antibody specifically targets and binds to ofloxacin, a widely used antibiotic, preventing its action on bacteria.</p>