Prodotti biochimici e reagenti

<p>Rabbit Polyclonal GPT antibody (biotin)</p>

<p>MMP9 antibody was raised in rabbit using residues 540-552 [WRFSEGRGSRPQG] of the 92 kDa human MMP9 protein as the immunogen.</p>

<p>EGFR antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Peptide named cardiac myosin heavy chain (Myhc)-α 334–352 induces autoimmune myocarditis in mice bearing H-2 allele IAk.</p>

<p>Rabbit polyclonal SDP3 antibody (HRP)</p>

<p>TAAR5 antibody was raised in rabbit using the C terminal of TAAR5 as the immunogen</p>

<p>Blocker of α3β2, α7 and α4β2 nAChRs</p>

<p>CACYBP antibody is a serum marker used in Life Sciences to detect the presence of dopamine. It is commonly used in research involving pluripotent stem cells. This antibody specifically targets CACYBP, a protein involved in various cellular processes. The CACYBP antibody can be used for chromatographic and immunological assays to study the activation and function of CACYBP. It can also be used as a diagnostic tool to detect autoantibodies associated with certain diseases. Additionally, this antibody can be used in the development of monoclonal antibodies or other therapeutic agents targeting CACYBP. Its application extends to studies involving methyl transferase activity, interferon-stimulated gene expression, acetylcholine signaling, and transmembrane conductance.</p>

<p>CD45RO Monoclonal Antibody (HRP)</p>

<p>The Beta catenin antibody is a highly versatile antibody that plays a crucial role in various biological processes. It is commonly used in life sciences research, particularly in the field of pluripotent stem cells. This antibody specifically targets β-catenin, a protein that is involved in cell adhesion and signaling pathways.</p>

<p>The beta Actin antibody is a highly specific monoclonal antibody that targets the beta-actin protein. It is widely used in research and diagnostic applications to detect and quantify the expression levels of beta-actin in various samples, including human serum. This antibody has been proven to be cytotoxic towards cells expressing sclerostin, an antigen associated with bone disorders. The beta Actin antibody can be used in a variety of assays, including Western blotting, immunohistochemistry, and flow cytometry, to study the localization and function of beta-actin in different cellular contexts. Its high specificity and sensitivity make it an indispensable tool for researchers studying cellular processes such as cell motility, cytoskeletal dynamics, and intracellular signaling pathways involving beta-actin.</p>

<p>The USP7 antibody is a monoclonal antibody that specifically binds to the receptor for colony-stimulating factor (CSF). This antibody has been shown to have cytotoxic effects on cells that express high levels of the CSF receptor, making it a promising therapeutic option in the field of life sciences. The USP7 antibody works by neutralizing the activity of CSF, which is a growth factor involved in cell proliferation and differentiation. By blocking the binding of CSF to its receptor, this antibody inhibits the downstream signaling pathways that promote cell growth and survival. Additionally, the USP7 antibody has been found to interact with calmodulin and form dimers, which further enhances its cytotoxic effects. With its ability to selectively target activated cells expressing high levels of the CSF receptor, this monoclonal antibody holds great potential for targeted therapy in various diseases.</p>

<p>16:0-16:0-d31 Pc is a synthetic peptide that is used as an inhibitor of 16:0-16:0 binding to the receptor. The peptide has been shown to bind to the ligand binding domain in the extracellular loop of the receptor and prevent it from activating the ion channels. This peptide is also used as a research tool for studying protein interactions, and can be used in pharmacology, life science, and cell biology.</p>

<p>IGSF1 antibody was raised using the middle region of IGSF1 corresponding to a region with amino acids TMAIFSIDNLTPEDEGVYICRTHIQMLPTLWSEPSNPLKLVVAGGCGYGC</p>

<p>Rabbit polyclonal THOC7 antibody</p>

<p>Rabbit polyclonal HS71L antibody</p>

<p>Insecticidal peptide against Spodoptera frugiperda</p>

<p>HSPC111 antibody was raised using the middle region of HSPC111 corresponding to a region with amino acids RKVKAMEVDIEERPKELVRKPYVLNDLEAEASLPEKKGNTLSRDLIDYVR</p>

<p>Selective blocker of SK2 (KCa2.2) channels</p>

<p>The Alkaline Phosphatase antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets the alkaline phosphatase enzyme, which plays a crucial role in various biological processes such as glycosylation, exocytosis, and nuclear signaling. This antibody binds to the active site of alkaline phosphatase and inhibits its activity, allowing researchers to study the effects of its inhibition on cellular functions.</p>

<p>The ST3GAL4 antibody is a powerful tool used in Life Sciences research. It is an antibody that specifically targets and binds to the ST3GAL4 protein, which plays a crucial role in various biological processes. This antibody has been extensively studied and proven to be effective in applications such as immunohistochemistry, immunofluorescence, Western blotting, and flow cytometry.</p>

<p>5-Methyl cromolyn sodium is a potent inhibitor of the release of histamine and leukotrienes from mast cells and basophils. It is used to prevent allergic reactions because it blocks the activation of these cells. Cromolyn sodium has also been shown to be an effective treatment for asthma, chronic obstructive pulmonary disease (COPD), and other respiratory diseases. 5-Methyl cromolyn sodium has been shown to inhibit ion channels, which may lead to its antihistamine activity. This drug has been shown to bind with high affinity to a number of receptor ligands including peptides, antibodies, and cell biology proteins.</p>

<p>NANP antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KLHL8 antibody, catalog no. 70R-8348</p>

<p>Mouse monoclonal EPSP synthase antibody</p>

<p>NSC305787 is a small molecule modulator, which is derived from synthetic sources. It exhibits its mode of action by interfering with specific cell signaling pathways, ultimately influencing cellular processes. The compound is particularly known for its ability to inhibit or modify the activity of certain proteins involved in these pathways, offering insight into cellular behavior and potential intervention points for various biological systems.</p>

<p>Rabbit polyclonal alpha Synuclein antibody (Tyr136)</p>

<p>RTCD1 antibody was raised using the N terminal of RTCD1 corresponding to a region with amino acids VQKIRAGRSTPGLRPQHLSGLEMIRDLCDGQLEGAEIGSTEITFTPEKIK</p>

<p>Overlaping peptide library of Spike Omicron mutant. 15 amino acids per peptide with offset 11. Purity crude. 1 peptide per well.</p>

<p>Soporidine is an inhibitor of protein interactions, which is used in the study of receptor-ligand interactions. Soporidine has been shown to activate some receptors and inhibit others. It has also been shown to be a potent inhibitor of ion channels and may be useful as a research tool for studying ion channel function.</p>

<p>Purified Rabbit polyclonal CD32 antibody (Tyr292)</p>

<p>GCOM1 antibody was raised using the middle region of Gcom1 corresponding to a region with amino acids VAQVENQLLKMKVESSQEANAEVMREMTKKLYSQYEEKLQEEQRKHSAEK</p>

<p>Vactosertib hydrochloride is a small molecule that binds to the receptor tyrosine kinase AXL and inhibits its activity. It has been shown to inhibit the proliferation of cancer cells in vitro. Vactosertib hydrochloride can also be used as a research tool for studying protein interactions, ion channels, and cell biology.</p>

<p>The Elastin antibody is a neutralizing inhibitor that is widely used in Life Sciences research. It specifically targets protein kinases involved in the regulation of TGF-beta signaling pathway, P2X receptors, and collagen synthesis. This antibody has been shown to effectively block the activation of these proteins, preventing the downstream effects such as proton release, superoxide production, and chemokine secretion. Additionally, the Elastin antibody is commonly used for immunohistochemistry and immunofluorescence experiments to detect elastin expression in various tissues and cell types. It is a polyclonal antibody derived from animals and exhibits high specificity and sensitivity. Researchers often rely on this antibody to study the role of elastin in various biological processes and its potential as a therapeutic target for conditions related to mesenchymal stem cells dysfunction.</p>

<p>Biotin-SARS-CoV-2 Spike RBD 352-365 peptide is the biotinylated version of SARS-CoV-2 Spike RBD 352-365 peptide. SARS-CoV-2 Spike RBD 352-365 peptide is an epitope of interest of the SARS-CoV-2 Spike S glycoprotein Receptor-Binding Domain (RBD). Biotin-SARS-CoV-2 Spike RBD 352-365 peptide is useful for vaccine development and for structure-activity relationship studies<br>SARS-CoV-2 Spike (S) glycoprotein<br>Spike (S) glycoprotein corresponds to one of the leading targets for COVID-19 disease. Present on the surface of Sars-CoV-2 virus, Spike S protein is a class I fusion protein that allows the virus to enter host cells.<br>With a 1 273 aa length, Spike protein has 2 subunits : S1 contains the receptor-binding domain RBD and S2 induces the fusion of the viral envelop with the cellular membrane.<br>SARS-CoV-2 Spike RBD:<br>The receptor-binding domain in SARS-CoV-2 Spike protein allows binding to the Angiotensin-Converting Enzyme receptor 2 (ACE2 receptor) which mediates the viral entry.</p>

<p>RNF139 antibody was raised using the N terminal of RNF139 corresponding to a region with amino acids SQRSLFKFYTYSSAFLLAATSVLVNYYASLHIDFYGAYNTSAFGIELLPR</p>

<p>Rabbit polyclonal GPR27 antibody</p>

<p>Mouse anti-goat IgG (H + L) (HRP) was raised in mouse using goat IgG (H &amp; L) as the immunogen.</p>

<p>Purified Polyclonal GUCY1B3 antibody</p>

<p>BMP7 antibody was raised in rabbit using highly pure recombinant human BMP-7 as the immunogen.</p>

<p>Rabbit polyclonal CBX6 antibody</p>

<p>TNFSF12 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets and binds to the TNFSF12 molecule, which is involved in various biological processes such as cell growth, differentiation, and immune response. This antibody has been extensively studied and shown to effectively block the activity of TNFSF12, thereby modulating its downstream effects.</p>

<p>The Collagen Type IV antibody is a powerful tool in the field of Life Sciences. Produced by hybridoma cells, this antibody specifically targets collagen, a vital component of connective tissues. It has been shown to have inhibitory effects on helicobacter growth and can be used to detect autoantibodies in various diseases. Additionally, the Collagen Type IV antibody can be utilized as a substrate for siRNA delivery or as an anti-connexin agent. With its high specificity and affinity, this monoclonal antibody is widely used in research laboratories for studying endothelial growth and the role of collagen in various biological processes.</p>

<p>I-Stat (trisodium) is a peptide that binds to ion channels and can activate or inhibit them. It has been used in research as a tool for examining the interactions of proteins. I-Stat (trisodium) has been shown to have high purity, and it is an inhibitor of calcium channels.</p>

<p>MKL1 antibody was raised in rabbit using the C terminal of MKL1 as the immunogen</p>

<p>Primary SIL peptide for Dupilimab detection and quantification</p>

<p>Rabbit polyclonal PDGFRa antibody (Tyr849)</p>

<p>Triiodothyronine antibody was raised in mouse using triiodothyronine-BSA as the immunogen.</p>

<p>Rabbit polyclonal OLFML2B antibody</p>

<p>NVP-QAV 680 is a kinase inhibitor, which is a synthetic compound designed to obstruct the enzymatic activity of specific kinases involved in various cellular processes. It is derived from precise chemical synthesis, allowing for targeted interaction with the ATP-binding pockets of kinases pertinent to oncogenic signaling pathways. The mode of action involves competitive inhibition, where NVP-QAV 680 competes with ATP, effectively decreasing the phosphorylation of downstream substrates and resulting in the inhibition of aberrant cell proliferation.</p>

<p>PF-06284674 is a potent and selective small molecule activator of the human angiotensin II type 1 receptor. Angiotensin II is a hormone that regulates blood pressure, water and electrolyte balance, and vascular tone. The activation of the angiotensin II type 1 receptor by PF-06284674 has been shown to produce vasodilation in various tissues including the kidney, heart, and brain. PF-06284674 may be useful for research purposes as an inhibitor of protein interactions or an antibody production tool.</p>

<p>Rabbit polyclonal SLC19A3 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of EVX2 antibody, catalog no. 70R-9601</p>

<p>Mouse anti Human IgG4 pFC antibody - HRP conjugate</p>

<p>Purified Polyclonal GNL1 antibody</p>

<p>IKZF3 antibody was raised in Rabbit using Human IKZF3 as the immunogen</p>

<p>UBE2C antibody was raised using the middle region of UBE2C corresponding to a region with amino acids QGNICLDILKEKWSALYDVRTILLSIQSLLGEPNIDSPLNTHAAELWKNP</p>

<p>FBG2 antibody was raised in rabbit using residues 268-284 (SEAQPGQKHGQEEAAQS) of the human FBG2 protein as the immunogen.</p>

<p>6-Hydroxy ramulosin is a potent kinase inhibitor that has shown promising anticancer activity in both preclinical and clinical studies. This compound has been found to inhibit the activity of multiple kinases involved in cancer progression, including those responsible for cell proliferation, survival, and angiogenesis. Additionally, 6-Hydroxy ramulosin has been shown to induce apoptosis in cancer cells by disrupting key signaling pathways involved in tumor growth. This compound is derived from Chinese medicinal plants and has been found in human urine samples, indicating its potential as a natural anticancer agent. With its potent inhibitory effects on kinases and ability to induce apoptosis in cancer cells, 6-Hydroxy ramulosin holds great promise as a novel therapeutic for the treatment of various types of cancer.</p>

<p>Rabbit polyclonal DAPP1 antibody (Tyr139)</p>

<p>Lamin A+C Monoclonal Antibody (HRP)</p>

<p>STAT5B antibody was raised in rabbit using the C terminal of STAT5B as the immunogen</p>

<p>Purified Rabbit polyclonal NCF1 antibody</p>

<p>Purified Rabbit polyclonal KIF2C antibody</p>

<p>Rabbit polyclonal TCF7L2 antibody</p>

<p>Rabbit polyclonal MAPK9 antibody</p>

<p>Phytase antibody is a monoclonal antibody that targets and inhibits the activity of phosphatase enzymes. It has been shown to reduce microvessel density and inhibit the growth of blood vessels in tumors. This antibody specifically binds to sclerostin, a protein involved in bone metabolism, and has been found to increase bone mineral density. Additionally, phytase antibody has shown potential as a therapeutic agent for various diseases such as cancer and autoimmune disorders by targeting chemokines, collagen, alpha-fetoprotein, and interleukins. Its cytotoxic effects make it a promising candidate for targeted cancer therapy.</p>

<p>MPP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids QGVGRRSLKNKLIMWDPDRYGTTVPYTSRRPKDSEREGQGYSFVSRGEME</p>

<p>Nav1.7 selective blocker</p>

<p>1-Tosyl-1H-pyrrolo[2,3-b]pyridine-3-carbaldehyde is a ligand that is used as a research tool for studying protein interactions and receptor activation. It can be used to study ion channels, cell biology, and pharmacology. 1-Tosyl-1H-pyrrolo[2,3-b]pyridine-3-carbaldehyde has been shown to inhibit the binding of an antibody to its antigen in an ELISA assay. This inhibitor is also a high purity reagent with CAS number 956716-93-1.</p>

<p>The PAI antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets and binds to the activated tyrosine kinase receptor, which plays a crucial role in cell signaling pathways. By binding to this receptor, the PAI antibody inhibits its activity and prevents the transmission of signals that promote cell growth and proliferation.</p>

<p>Please enquire for more information about Gliadin protein from Wheat including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>XMD17-109 is a drug that inhibits the mitogen-activated protein kinase (MAPK) pathway, which is a signaling cascade that regulates cell proliferation. This compound has been shown to inhibit the activation of MAPK in response to a variety of extracellular stimuli. XMD17-109 also inhibits the expression of genes involved in cardiovascular diseases, such as angiotensin and cortistatin. XMD17-109 blocks the proliferation of vascular smooth muscle cells and osteopontin by downregulating α-smooth muscle actin (α-SMA) and upregulating osteopontin.</p>

<p>Biotin-SARS-CoV-2 Spike RBD 336-347 peptide is the biotinylated version of SARS-CoV-2 Spike RBD 336-347 peptide. SARS-CoV-2 Spike RBD 336-347 peptide is an epitope of interest of the SARS-CoV-2 Spike S glycoprotein Receptor-Binding Domain (RBD). Biotin-SARS-CoV-2 Spike RBD 336-347 peptide is useful for vaccine development and for structure-activity relationship studies<br>SARS-CoV-2 Spike (S) glycoprotein<br>Spike (S) glycoprotein corresponds to one of the leading targets for COVID-19 disease. Present on the surface of Sars-CoV-2 virus, Spike S protein is a class I fusion protein that allows the virus to enter host cells.<br>With a 1 273 aa length, Spike protein has 2 subunits : S1 contains the receptor-binding domain RBD and S2 induces the fusion of the viral envelop with the cellular membrane.<br>SARS-CoV-2 Spike RBD:<br>The receptor-binding domain in SARS-CoV-2 Spike protein allows binding to the Angiotensin-Converting Enzyme receptor 2 (ACE2 receptor) which mediates the viral entry.</p>

<p>The ID3 antibody is a monoclonal antibody that is widely used in the field of Life Sciences. It specifically targets and binds to fibroin, a protein involved in various cellular processes. This monoclonal antibody has been extensively studied and is known for its high specificity and affinity towards fibroin.</p>

<p>Petroselaidic acid is a natural product that belongs to the hydroxybenzoic acid family of fatty acids. It is present in many plant species, especially in seeds and leaves. Petroselaidic acid has been shown to have detergent properties, which are probably due to its ability to solubilize phospholipids and inhibit the activity of alkaline phosphatase. This compound also has hemolytic activity, which may be related to its ability to bind with erythrocytes by electrostatic interactions. Petroselaidic acid is an analog of petroselinic acid, a fatty acid found in plants that has been shown to induce tumefaciens-mediated transformation.</p>

<p>Mouse monoclonal MAPK1 antibody</p>

<p>4-Benzyloxy beta-hydroxy tamoxifen is a peptide inhibitor of the estrogen receptor. It binds to the ligand-binding domain, preventing interaction with coactivators that are needed for transcriptional activation. 4-Benzyloxy beta-hydroxy tamoxifen has been used as a research tool to study protein interactions and antibody binding. The compound also has pharmacological effects on ion channels and cell biology. 4-Benzyloxy beta-hydroxy tamoxifen can be used as an inhibitor of the estrogen receptor, and it is highly purified.</p>

<p>UMB298 is a potent inhibitor of human xylose kinase, which is a key enzyme involved in the metabolism of d-xylose. This compound has shown promising results in inducing apoptosis and inhibiting the growth of cancer cells. UMB298 has been studied extensively for its potential as an anticancer agent, particularly in Chinese hamster ovary cells and human urine tumor cell lines. It has also been found to inhibit other kinases, including protein kinase C and casein kinase II, which may contribute to its anticancer activity. Overall, UMB298 shows great potential as a targeted therapy for cancer treatment.</p>

<p>Purified recombinant TSSK2 protein (His tag)</p>

<p>IAA-BSA is a hapten conjugate that is commonly used in Life Sciences research. It is a reactive compound that can be easily attached to an electrode or other surfaces for various applications. IAA-BSA has been widely used in studies related to collagen, monoclonal antibodies, and mitochondrial superoxide. It has shown neutralizing effects on certain monoclonal antibodies and has been found to modulate hepatocyte growth factor signaling pathways. Additionally, IAA-BSA has been used in the study of epidermal growth factor receptor (EGFR) and phosphoinositide 3-kinase (PI3K) signaling pathways. Its acidic nature allows it to bind to various proteins and antigens, making it a valuable tool for researchers in the field of Proteins and Antigens.</p>

<p>ASP 9521 is a potent, orally available inhibitor of the human androgen receptor. ASP 9521 is a non-steroidal, antiandrogen drug that binds to the androgen receptor with high affinity (Ki=5 nM) and selectivity. The compound has been shown to inhibit prostate cancer cell growth in vitro and in vivo. This agent has been shown to be well tolerated in animals at doses up to 200 mg/kg/day for 14 days, with no evidence of toxicity or adverse effects.</p>

<p>The IL4 antibody is a monoclonal antibody that targets the β-catenin protein. It has cytotoxic properties and acts as a growth factor inhibitor. This antibody specifically binds to IL4, preventing its interaction with its receptor and inhibiting downstream signaling pathways. Additionally, the IL4 antibody has anti-dnp antibodies, antiangiogenic effects, and interferon neutralizing activity. It can induce apoptosis by activating caspase-9 and has been shown to have potent antitumor effects in various cancer models. The IL4 antibody is widely used in Life Sciences research for studying endothelial growth, immune responses, and cell lysis.</p>

<p>Oleacein is a phenolic compound, which is a secoiridoid derivative primarily found in olive leaves and extra virgin olive oil. It is derived from the hydrolysis of oleuropein during oil extraction and storage. Oleacein exerts its mode of action through its potent antioxidant and anti-inflammatory properties, functioning by scavenging free radicals and modulating pathways involved in inflammatory responses.</p>

<p>NT-proBNP antibody was raised in mouse using synthetic N-terminal pro brain natriuretic peptide (NT-proBNP), corresponding to amino acid residues 13-27 as the immunogen.</p>

<p>Reticuline hydrochloride is a racemic mixture of enantiomers. It is a crystalline solid that has a melting point of 222°C. Reticuline hydrochloride is an alkaloid derived from thebaine and other opium alkaloids. It is found in the plants, Mandragora officinarum and Berberis aristata. The drug has been shown to have analgesic, antitussive, anti-inflammatory, and antipyretic properties. Reticuline hydrochloride has also been found to be useful for treating malaria.</p>

<p>Rabbit polyclonal COL4A2 antibody (HRP)</p>

<p>GsMTx4 is a ryanodine receptor agonist that binds to the ryanodine receptor and activates signal pathways. It has been shown to activate mechanosensitive channels and regulate intracellular Ca2+ levels by inducing an increase in Ca2+ release from the endoplasmic reticulum. GsMTx4 has also been shown to have pharmacological effects on cells, as well as physiological effects on Grammostola spatulata, such as inhibition of locomotion and increased mortality. GsMTx4 has also been shown to have antiviral properties against infectious diseases such as influenza, herpes simplex virus-1, and West Nile virus.</p>

<p>Neuropeptide:<br>Neuropeptides are small signaling molecules produced and released by neurons engaged in many physiological functions. Indeed, neuropeptides act on neural substrates such as G protein-coupled receptors (GPCRs), tyrosine-kinase receptor, insuline-like peptides and also ion channels. Actions of neuropeptides result in slow-onset, long-lasting modulation of synaptic transmission.<br>Neuropeptide NPSF (SQAFLFQPQRF-NH2):<br>Neuropeptide NPSF (SQAFLFQPQRF-NH2) is part of the FMRFamide-related peptides family. Neuropeptide NPSF has shown an important role in pain regulation and plays a role of anti-opiate. Moreover, Neuropeptide NPSF seems to be implicate in variety of physiological processes such as food intake, insulin release, blood pressure regulation and electrolyte balance. Neuropeptide NPSF (SQAFLFQPQRF-NH2) is useful in opioid research.</p>

<p>SQSTM1 antibody is a monoclonal antibody that targets the SQSTM1 protein, also known as p62. This protein plays a crucial role in various cellular processes, including hepatocyte growth, TNF-α signaling, collagen degradation, and autophagy. The SQSTM1 antibody specifically binds to the SQSTM1 protein and can be used for various applications in research and diagnostics.</p>

<p>Rabbit polyclonal SIGLEC5 antibody</p>

<p>Rabbit polyclonal WRKY71 antibody</p>

<p>N-[(1R)-1-[3-[[12-Methyl-8-(methylamino)-5-thia-3,7,10,12-tetrazatricyclo[7.3.0.02,6]dodeca-1(9),2(6),3,7,10-pentaen]-4-yl]phenyl]ethyl]-2-methylsulfonylbenzamide is a research tool that belongs to the ligand class of inhibitors and is used in pharmacology as a cell biology research tool. It has CAS No. 1779493-12-7 and can be used for the inhibition of ion channels or ligands involved in protein interactions. N-[(1R)-1-[3-[12-Methyl-8-(methylamino)-5 -thia -3,7,10,12 -tetrazatricyclo [7.3.0.</p>

<p>Cer9 is a peptide that belongs to the group of activators. It binds to receptors and activates them, which can lead to changes in the ion channels in cell membranes. This leads to an increase in the permeability of the membrane and an influx of ions. Cer9 is also used as a research tool for understanding protein interactions, receptor binding, and ligand-receptor binding.</p>

<p>13-[(2-Fluorophenyl)methyl]-5,6-dihydro-9,10-dimethoxy-benzo[g]-1,3-benzodioxolo[5,6-a]quinolizinium chloride is a synthetic heterocyclic compound, which is a derivative of quinolizinium chloride. It is synthesized through a series of chemical reactions involving arylation and cyclization, leveraging fluorinated aromatic substrates as precursors. The mode of action of this compound typically involves interactions with nucleic acids or enzyme systems, making it a potential candidate for studying biological pathways and molecular interactions.</p>

<p>The MCL1 antibody is a highly specialized monoclonal antibody that targets the growth factor MCL1. It plays a crucial role in regulating cell survival and apoptosis. This antibody specifically binds to MCL1, inhibiting its activity and promoting cell death in cancer cells.</p>

<p>Please enquire for more information about N-[(1S,2S,3R)-3-(5,6-Dihydrobenzo[b][1]benzazepin-11-yl)-2-hydroxycyclohexyl]-4-(trifluoromethoxy)benzenesulfonamide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>IKZF3 antibody was raised in rabbit using the C terminal of IKZF3 as the immunogen</p>

<p>THZ1 is a kinase inhibitor that inhibits the activity of cyclin-dependent kinases. It has been shown to induce apoptosis in cancer cells and inhibit tumor growth. THZ1 also inhibits breast cancer cell proliferation, which may be due to its ability to inhibit cell cycle progression by blocking transcriptional and translational activities.</p>

<p>CIRBP antibody was raised using the N terminal of CIRBP corresponding to a region with amino acids MASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFG</p>