Prodotti biochimici e reagenti

<p>ARHGAP19 antibody was raised in rabbit using the C terminal of ARHGAP19 as the immunogen</p>

<p>RYBP antibody was raised in Rabbit using Human RYBP as the immunogen</p>

<p>The NSE antibody is a monoclonal antibody that is used in particle reaction assays to detect the presence of neuronspecific enolase (NSE). NSE is an enzyme that is primarily found in neurons and neuroendocrine cells. This antibody specifically binds to NSE, allowing for its detection in various biological samples. The NSE antibody has been widely used in research and diagnostic applications in the Life Sciences field. It has also been used in studies investigating the role of NSE in cell growth and differentiation, as well as its association with diseases such as cancer. Additionally, this antibody has been utilized in experiments examining the effects of growth factors and cox-2 inhibitors on NSE expression and activity. Its high specificity and sensitivity make it a valuable tool for researchers studying neuronal development, function, and pathology.</p>

<p>Purified Polyclonal ACC alpha antibody</p>

<p>Chk1 antibody is a high-quality polyclonal antibody that is used in Life Sciences research. It specifically targets the Chk1 protein, which plays a crucial role in cell cycle regulation and DNA damage response. This antibody has been extensively validated and proven to be highly specific and sensitive in detecting Chk1 in various experimental settings. It is suitable for use in immunofluorescence, immunohistochemistry, western blotting, and other applications.</p>

<p>Purified Rabbit polyclonal PLEKHA8 antibody</p>

<p>Cystathionase antibody was raised using a synthetic peptide corresponding to a region with amino acids ESNPWVEKVIYPGLPSHPQHELVKRQCTGCTGMVTFYIKGTLQHAEIFLK</p>

<p>Mouse monoclonal TAL1 antibody</p>

<p>The WWP1 antibody is a highly specific antibody used in Life Sciences research. It is commonly used to study the role of WWP1, an E3 ubiquitin-protein ligase, in various biological processes. This monoclonal antibody binds to WWP1 and can be used for immunohistochemistry, western blotting, and other experimental techniques. The WWP1 antibody is particularly useful for investigating the interaction between WWP1 and its substrates, such as collagen, adiponectin, transferrin, and alpha-fetoprotein. Researchers can use this antibody to gain insights into the function of WWP1 in adipocytes, liver microsomes, and other tissues. With its high specificity and reliability, the WWP1 antibody is an essential tool for studying the molecular mechanisms underlying various physiological processes.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ORAI2 antibody, catalog no. 70R-6919</p>

<p>TMEM115 antibody was raised using the N terminal of TMEM115 corresponding to a region with amino acids LLSFAVDTGCLAVTPGYLFPPNFWIWTLATHGLMEQHVWDVAISLTTVVV</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C19orf46 antibody, catalog no. 70R-6674</p>

<p>Full length HBcAg protein (183 amino acids)</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is specifically designed to combat tuberculosis infection by targeting active compounds and exhibiting potent bactericidal activity. Through its unique mechanism of action, this drug binds to DNA-dependent RNA polymerase, hindering transcription and replication processes in bacteria. Extensive research has shown its efficacy using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique.</p>

<p>Purified recombinant UMPS protein</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SNUPN antibody, catalog no. 70R-4636</p>

<p>ACAA1 antibody was raised in Rabbit using Human ACAA1 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KCNK10 antibody, catalog no. 70R-1534</p>

<p>Purified Polyclonal NXF1 antibody</p>

<p>Rabbit Polyclonal ZNF649 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CANT1 antibody, catalog no. 70R-5808</p>

<p>Rabbit polyclonal RABGAP1L antibody</p>

<p>Escherichia coli 0157 Monoclonal Antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLC45A2 antibody, catalog no. 70R-6692</p>

<p>SAA1 protein is a monoclonal antibody that specifically targets the protein angptl3. This protein plays a crucial role in hepatocyte growth and has been shown to have cytotoxic effects on certain cancer cells. The SAA1 protein is widely used in Life Sciences research for its ability to detect and quantify angptl3 levels in various samples. It forms dimers with the target protein, allowing for easy detection and analysis. Additionally, the SAA1 protein can be activated to enhance its binding affinity and specificity. It is commonly used in studies involving Recombinant Proteins &amp; Antigens, collagen, levothyroxine, and epidermal growth factor. The SAA1 protein also has neutralizing properties, making it an important tool for investigating the biological functions of angptl3 and developing potential therapeutic interventions.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZMIZ2 antibody, catalog no. 70R-10130</p>

<p>Region of BMP6 protein corresponding to amino acids VSSASDYNSS ELKTACRKHE LYVSFQDLGW QDWIIAPKGY AANYCDGECS FPLNAHMNAT NHAIVQTLVH LMNPEYVPKP CCAPTKLNAI SVLYFDDNSN VILKKYRNMV VRACGCH.</p>

<p>The LRP antibody is a glycoprotein that belongs to the family of activated monoclonal antibodies. It specifically targets the cysteine-rich protein, which is known to be an angiogenic inducer. This antibody is widely used in Life Sciences for various applications, including the detection and quantification of autoantibodies. The LRP antibody can also be used as a tool in research studies to investigate the role of binding proteins and chemokines in different cellular processes. Additionally, this monoclonal antibody has cytotoxic properties and can be utilized as a potential therapeutic agent for inhibiting transmembrane conductance. Its versatility and specificity make it an invaluable tool in scientific research and medical applications.</p>

<p>Chenodeoxycholic acid antibody is a monoclonal antibody that specifically targets and binds to chenodeoxycholic acid, a bile acid found in the adipose tissue. This antibody is produced using human monoclonal antibodies and has been shown to have anti-connexin activity. It can inhibit the activation of c-myc, a glycoprotein involved in cell growth and proliferation. Chenodeoxycholic acid antibody can be used as a research tool for studying the role of chenodeoxycholic acid in various biological processes. Additionally, it has potential applications in therapeutic settings, such as targeted drug delivery or as an antibody-drug conjugate for treating specific diseases related to chenodeoxycholic acid metabolism or signaling pathways.</p>

<p>Lenperone hydrochloride is a peptide of the amino acid sequence Ac-D-Ala-Nle-Nle-Phe-Gly-D-Arg. It is an activator of ion channels and has been used as a research tool to study protein interactions. Lenperone hydrochloride interacts with receptors, ligands, and other proteins in cells. It can be used to investigate the role of ion channels in cell signaling and to understand how protein interactions are involved in the development of diseases such as cancer.</p>

<p>Rat monoclonal CD4 antibody (PE); mouse target; IgG2a kappa; clone RM4-5</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C14orf126 antibody, catalog no. 70R-9183</p>

<p>Purified recombinant LY6G6F protein (His tag)</p>

<p>ATP2A1 antibody was raised using the N terminal of ATP2A1 corresponding to a region with amino acids MEAAHAKTTEECLAYFGVSETTGLTPDQVKRNLEKYGLNELPAEEGKTLW</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RAB31 antibody, catalog no. 70R-10405</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of HSF5 antibody, catalog no. 70R-8700</p>

<p>Rabbit polyclonal SH2D3C antibody</p>

<p>The CD45 antibody is a growth factor that plays a crucial role in various biological processes. It is a glycoprotein with sugar moieties and contains domains similar to epidermal growth factor (EGF) and transforming growth factor-beta (TGF-beta). This antibody has been extensively studied in the field of Life Sciences and has shown promising results.</p>

<p>Affinity purified Rabbit polyclonal SCMH1 antibody</p>

<p>Mouse monoclonal FCGR2A antibody</p>

<p>Protein A-Poly-HRP40 conjugate for use in immunoassays</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ATG16L1 antibody, catalog no. 70R-2845</p>

<p>Etomidate hydrochloride is a potent sedative and hypnotic agent that belongs to the class of imidazole derivatives. It is a fast-acting drug with an onset of action in 5 minutes and peak activity at 15 minutes. Etomidate hydrochloride has been extensively used as a general anesthetic for induction of anesthesia, and is effective in inducing rapid recovery from anesthesia. Etomidate hydrochloride has also been studied as a treatment for status epilepticus.</p>

<p>Rabbit polyclonal SMEK2 antibody</p>

<p>The Transgelin antibody is a highly specialized product used in Life Sciences research. It is a monoclonal antibody that specifically targets the protein transgelin. Transgelin plays a crucial role in various cellular processes, including steroid synthesis, adeno-associated virus infection, acetyltransferase activity, and electrode function.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NCAM2 antibody, catalog no. 70R-6446</p>

<p>Mouse monoclonal GPHN antibody</p>

<p>CCDC93 antibody was raised in Rabbit using Human CCDC93 as the immunogen</p>

<p>Oxyphenbutazone Conjugate for use in immunoassays</p>

<p>Purified recombinant Human XRCC3 protein (His tag)</p>

<p>Goat anti-cat IgG (Rhodamine) was raised in goat using feline IgG F(c) fragment as the immunogen.</p>

<p>Cyclin Y antibody was raised using the middle region of CCNY corresponding to a region with amino acids DENLHPLSKSEVPPDYDKHNPEQKQIYRFVRTLFSAAQLTAECAIVTLVY</p>

<p>The SLC25A1 antibody is a highly specialized antibody used in the field of Life Sciences. It specifically targets the SLC25A1 protein, which is responsible for transporting creatine, an essential molecule involved in energy metabolism. This antibody can be used in various research applications, including the study of growth factors and their effects on cellular processes.</p>

<p>The ING5 antibody is a highly specialized tool used in the field of life sciences. It is a polyclonal antibody that specifically targets hepatic lipase, a receptor binding protein involved in cholesterol synthesis. This antibody can be used in various research applications, including immunoprecipitation and Western blotting.</p>

<p>ALDOC protein is a key component of the Proteins and Antigens family. It can be activated by monoclonal antibodies and has a strong affinity for streptavidin binding proteins. This chemokine plays an important role in various biological processes, including cell migration and immune response. ALDOC protein can be detected using a specific monoclonal antibody through techniques such as hybridization or immunohistochemistry. It is commonly used in Life Sciences research and diagnostic applications. ALDOC protein is stable in human serum and can be used to measure interferon levels or assess the efficacy of certain drugs, such as cefotiam. When conjugated with other proteins or excipients, ALDOC protein offers enhanced stability and functionality for various experimental purposes.</p>

<p>Human native cardiac troponin complex antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of APCS antibody, catalog no. 70R-1655</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NKAIN4 antibody, catalog no. 70R-7511</p>

<p>The CD40 antibody is a potent cytotoxic agent that targets pancreatic elastase and collagen. It has been shown to inhibit the activity of transforming growth factor-beta (TGF-beta) in human hepatocytes, which plays a crucial role in liver fibrosis. The CD40 antibody also binds to calmodulin, inhibiting the activity of elastase and preventing tissue damage. This monoclonal antibody has been used as a medicament in various therapeutic applications, including the treatment of autoimmune diseases and cancer. Additionally, it has natriuretic properties and can regulate the levels of growth factors in the body. With its wide range of effects, the CD40 antibody is a valuable tool for researchers and clinicians alike.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of AGXT2L2 antibody, catalog no. 70R-8763</p>

<p>Rabbit polyclonal TRAP1 antibody (biotin)</p>

<p>Rabbit polyclonal GPR114 antibody</p>

<p>Rabbit polyclonal MAP3K1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SFRS8 antibody, catalog no. 70R-1424</p>

<p>Hspb7 antibody was raised in rabbit using the C terminal of Hspb7 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Scfd2 antibody, catalog no. 70R-9215</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GDF2 antibody, catalog no. 70R-6213</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SERPINE1 antibody, catalog no. 70R-5427</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SRFBP1 antibody, catalog no. 70R-8997</p>

<p>ACSS2 antibody was raised in rabbit using the N terminal of ACSS2 as the immunogen</p>

<p>Affinity purified Rabbit polyclonal Selenophosphate synthetase 1 antibody</p>

<p>Rabbit polyclonal WRKY14 antibody</p>

<p>Rabbit polyclonal NUB1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MIER2 antibody, catalog no. 70R-4353</p>

<p>Rabbit polyclonal PDIA5 antibody</p>

<p>RELM beta antibody was raised in rabbit using residues 32-46 [DQRIKEALSRQEPKT] of the mouse RELM-Beta protein as the immunogen.</p>

<p>Affinity purified Rabbit polyclonal Stat4 antibody</p>

<p>p29 (GRA7) immunodominant regions of Toxoplasma gondii protein containing amino acids 24-100.</p>

<p>Affinity purified Rabbit polyclonal ATIC antibody</p>

<p>Rabbit Polyclonal CTNB1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PMS2 antibody, catalog no. 70R-5686</p>

<p>ART4 antibody was raised using a synthetic peptide corresponding to a region with amino acids TLCYEVHYRTKDVHFNAYTGATIRFGQFLSTSLLKEEAQEFGNQTLFTIF</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NOL5A antibody, catalog no. 70R-5008</p>

<p>PPP4C antibody was raised using a synthetic peptide corresponding to a region with amino acids TVLTVWSAPNYCYRCGNVAAILELDEHLQKDFIIFEAAPQETRGIPSKKP</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GRHL3 antibody, catalog no. 70R-7973</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DDX52 antibody, catalog no. 70R-4625</p>

<p>HTRA4 antibody was raised using the middle region of HTRA4 corresponding to a region with amino acids LKMHYPDFPDVSSGVYVCKVVEGTAAQSSGLRDHDVIVNINGKPITTTTD</p>

<p>MGP protein is a growth factor that can be used in various applications such as immobilization, Recombinant Proteins &amp; Antigens, and more. It is a monoclonal antibody that specifically binds to the target protein, making it an excellent tool for research purposes. MGP protein has been shown to interact with epidermal growth factor and other binding proteins, indicating its involvement in important cellular processes. With its high affinity and specificity, this protein can be used in experiments involving hybridoma cells, electrode assays, and protein-protein interactions. Additionally, MGP protein has been studied in relation to ubiquitin signaling pathways and the circumsporozoite protein of malaria parasites. Its role in regulating protein kinase activity further highlights its significance in the field of Life Sciences.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MCM2 antibody, catalog no. 70R-1613</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KCNK12 antibody, catalog no. 70R-5130</p>

<p>1-403 amino acids: MGSSHHHHHH SSGLVPRGSH MDRSKENCIS GPVKATAPVG GPKRVLVTQQ FPCQNPLPVN SGQAQRVLCP SNSSQRIPLQ AQKLVSSHKP VQNQKQKQLQ ATSVPHPVSR PLNNTQKSKQ PLPSAPENNP EEELASKQKN EESKKRQWAL EDFEIGRPLG KGKFGNVYLA REKQSKFILA LKVLFKAQLE KAGVEHQLRR EVEIQSHLRH PNILRLYGYF HDATRVYLIL EYAPLGTVYR ELQKLSKFDE QRTATYITEL ANALSYCHSK RVIHRDIKPE NLLLGSAGEL KIADFGWSVH APSSRRTTLC GTLDYLPPEM IEGRMHDEKV DLWSLGVLCY EFLVGKPPFE ANTYQETYKR ISRVEFTFPD FVTEGARDLI SRLLKHNPSQ RPMLREVLEH PWITANSSKP SNCQNKESAS KQS</p>

<p>SPATA17 antibody was raised using the C terminal of SPATA17 corresponding to a region with amino acids NMFLPFSSYHKNEKYIPSMHLSSKYGPISYKEQFRSENPKKWICDKDFQT</p>

<p>CACNB2 antibody was raised using the middle region of CACNB2 corresponding to a region with amino acids ADISLAKRSVLNNPSKHAIIERSNTRSSLAEVQSEIERIFELARTLQLVV</p>

<p>The GSTP1 antibody is a highly specific and potent antibody that targets the GSTP1 antigen. It belongs to the class of polyclonal antibodies and is widely used in life sciences research. This antibody is immobilized on various surfaces for applications such as protein purification, immunoassays, and antibody-drug conjugates. The GSTP1 antibody has been extensively studied and validated for its efficacy in detecting and quantifying GSTP1 levels in various samples.</p>

<p>Rabbit polyclonal UBL3 antibody</p>

<p>Goat anti-cat IgG was raised in goat using feline IgG F(ab')2 fragment as the immunogen.</p>

<p>The DCK antibody is a highly reactive antibody that specifically targets the catalase enzyme. It is widely used in Life Sciences research for the detection and analysis of catalase activity. This monoclonal antibody binds to catalase with high affinity, making it an excellent tool for studying the role of this enzyme in various biological processes.</p>

<p>Purified Polyclonal NFRKB antibody</p>

<p>The STIM2 antibody is a highly specific protein that acts as an anti-MERTK antibody. It is derived from a DNA aptamer and has been shown to effectively target and bind to activated MERTK receptors. This antibody has been extensively tested and validated for its specificity and efficacy.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ANGPTL7 antibody, catalog no. 70R-8822</p>