Prodotti biochimici e reagenti

<p>Cyclin D-Type Binding-Protein 1 antibody was raised using the middle region of CCNDBP1 corresponding to a region with amino acids KNVDFVKDAHEEMEQAVEECDPYSGLLNDTEENNSDNHNHEDDVLGFPSN</p>

<p>Rabbit polyclonal ERD22 antibody</p>

<p>Affinity purified Rabbit polyclonal Kininogen 1 antibody</p>

<p>HMGB2 antibody was raised in Rabbit using Human HMGB2 as the immunogen</p>

<p>IL1 alpha antibody was raised in goat using highly pure recombinant rat IL-1a as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PDE4B antibody, catalog no. 70R-2285</p>

<p>Affinity purified Rabbit polyclonal PHKA1 antibody</p>

<p>HCII antibody was raised in goat using human HCII purified from plasma as the immunogen.</p>

<p>The E2F1 antibody is a polyclonal antibody used in Life Sciences research. It specifically targets and binds to the E2F1 protein, which is involved in cell cycle regulation and apoptosis. This antibody can be used for various applications, including Western blotting, immunohistochemistry, and immunofluorescence. The E2F1 antibody has been shown to be effective in detecting the activation of tumor necrosis factor-alpha (TNF-α) and beta-catenin signaling pathways. It can also be used to study adipose tissue development and function. With its high specificity and sensitivity, this antibody is a valuable tool for researchers studying various cellular processes and signaling pathways.</p>

<p>LBP antibody was raised in Rabbit using Human LBP as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LOC652825 antibody, catalog no. 70R-2983</p>

<p>ZNF433 antibody was raised in rabbit using the N terminal of ZNF433 as the immunogen</p>

<p>Mouse monoclonal CST2 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of A2BP1 antibody, catalog no. 70R-8489</p>

<p>Region of IL5 protein corresponding to amino acids MEIPMSTVVK ETLTQLSAHR ALLTSNETMR LPVPTHKNHQ LCIGEIFQGL DILKNQTVRG GTVEMLFQNL SLIKKYIDRQ KEKCGEERRR TRQFLDYLQE FLGVMSTEWA MEG.</p>

<p>C9orf95 antibody was raised in rabbit using the N terminal of C9orf95 as the immunogen</p>

<p>Ergoloid Mesylates (USP grade powder) chemical reference substance</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting active compounds and exhibiting bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Its effectiveness has been proven through extensive testing using the patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it binds to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CD36 antibody, catalog no. 70R-6098</p>

<p>Recombinant Human BRD1 protein</p>

<p>The HDAC1 antibody is a highly specialized monoclonal antibody that targets the histone deacetylase 1 enzyme. This enzyme plays a crucial role in regulating gene expression by removing acetyl groups from histone proteins, thereby affecting chromatin structure and transcriptional activity. The HDAC1 antibody specifically binds to HDAC1 and inhibits its function, leading to increased acetylation of histones and altered gene expression patterns.</p>

<p>SLU7 antibody was raised using a synthetic peptide corresponding to a region with amino acids KKKELEEQRKLGNAPAEVDEEGKDINPHIPQYISSVPWYIDPSKRPTLKH</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF708 antibody, catalog no. 70R-8963</p>

<p>The Rb antibody is a highly specialized chemokine that plays a crucial role in various biological processes. It is commonly used in Life Sciences research and has proven to be an invaluable tool in studying different cellular pathways. This monoclonal antibody specifically targets the Rb protein, which is involved in regulating cell growth and division. By binding to the Rb protein, this antibody allows researchers to study its function and explore its potential as a therapeutic target.</p>

<p>Purified recombinant SPAG7 protein (His tag)</p>

<p>The DSG1 antibody is a highly specialized monoclonal antibody that has been activated to target and neutralize the growth factor known as HER2. This antibody is designed to specifically bind to the HER2 receptor, inhibiting its function and preventing the activation of downstream signaling pathways. By blocking HER2, the DSG1 antibody effectively halts the growth and proliferation of cancer cells that rely on this receptor for survival. In addition, this antibody has shown promising results in treating multidrug-resistant tumors, making it a valuable tool in the fight against cancer. With its unique amino group and carbonyl group structure, the DSG1 antibody exhibits high affinity and specificity for HER2, ensuring potent and targeted therapy. Trust in this cutting-edge antibody to deliver life-saving results in the field of oncology.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of OAS1 antibody, catalog no. 70R-5887</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PIWIL4 antibody, catalog no. 70R-2275</p>

<p>The KLF11 antibody is a histidine monoclonal antibody that targets β-catenin, a protein involved in cell adhesion and signaling pathways. This antibody has cytotoxic effects on cancer cells and has been shown to inhibit the growth of tumors in preclinical studies. Additionally, the KLF11 antibody has inhibitory properties against epidermal growth factor (EGF) and diacylglycerol (DAG), both of which play important roles in cellular processes. This antibody can be used in various applications within the life sciences field, including research and diagnostics. It is a valuable tool for studying signal transduction pathways and developing new therapeutic strategies for cancer treatment.</p>

<p>The SUV39H2 antibody is a high-quality polyclonal antibody that specifically targets the human protein SUV39H2. It can also be used in an antigen-antibody reaction to detect and measure the expression of SUV39H2 in various biological samples, such as granulosa cells. This antibody recognizes a unique amino-acid sequence in SUV39H2 and has been extensively validated for its specificity and sensitivity.</p>

<p>HAGH antibody was raised using the C terminal of HAGH corresponding to a region with amino acids STLAEEFTYNPFMRVREKTVQQHAGETDPVTTMRAVRREKDQFKMPRD</p>

<p>XBP1 antibody was raised in Mouse using a purified recombinant fragment of human XBP1 expressed in E. coli as the immunogen.</p>

<p>Purified recombinant OSGEP protein (His tag)</p>

<p>AKT3 antibody was raised in Rabbit using Human AKT3 as the immunogen</p>

<p>CHRNA5 antibody was raised in rabbit using the middle region of CHRNA5 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of HOXA9 antibody, catalog no. 70R-8438</p>

<p>Purified Polyclonal ANT4 antibody</p>

<p>Purified Polyclonal TIN2 antibody</p>

<p>(E)-Ceftiofur is a protein that has been shown to induce apoptosis in cancer cells. It is an analog of the antibiotic ceftiofur and acts as an anticancer agent by inhibiting kinases, which are enzymes involved in cell signaling pathways. (E)-Ceftiofur has been found to be effective against various types of cancers in both human and Chinese hamster ovary cells. It has also been shown to inhibit tumor growth in vivo. This drug may have potential as a novel kinase inhibitor for cancer therapy due to its ability to induce apoptosis and inhibit tumor growth.</p>

<p>7-Chloro-3,4-dihydro-2-(3-pyridyl)-1(2H)-naphthalenone is a prenylated aromatic amine that is metabolized to 1,4-benzodioxane by cytochrome P450 enzymes. The enzyme activities of 7-chloro-3,4-dihydro-2-(3-pyridyl)-1(2H)-naphthalenone have been shown to be dose dependent in rat liver microsomes and in testicular incubations. This compound is not reactive with the electron spin resonance spectrometer (ESR) at room temperature but becomes highly reactive when it is warmed up. This increased reactivity may be due to an increase in the concentration of free radicals or an increase in the number of accessible sites on the molecule after warming.</p>

<p>(4R)-3-(4-Chlorophenyl)-N-[(4-chlorophenyl)sulfonyl]-4,5-dihydro-N'-methyl-4-phenyl-1H-pyrazole-1-carboximidamide is a peptide that acts as an inhibitor. It binds to the ion channel and blocks the flow of ions. The peptide has been shown to inhibit potassium channels and sodium channels in cell biology experiments. The compound also has high purity and can be used as a research tool or an antibody. This product is not for sale to customers in the USA.</p>

<p>ING3 antibody was raised using the middle region of ING3 corresponding to a region with amino acids LSSGTGAGAITMAAAQAVQATAQMKEGRRTSSLKASYEAFKNNDFQLGKE</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MOS antibody, catalog no. 70R-5628</p>

<p>Purified Polyclonal AMYB antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GSTA4 antibody, catalog no. 70R-2577</p>

<p>MARCO antibody was raised using the N terminal of MARCO corresponding to a region with amino acids QARLRVLEMYFLNDTLAAEDSPSFSLLQSAHPGEHLAQGASRLQVLQAQL</p>

<p>The RFC2 antibody is a synthetic inhibitor that targets sirtuins, a class of enzymes involved in various cellular processes. This antibody acts as a peptide mimic and binds to the recombinant antigen, blocking its activity. It is widely used in industrial settings for research purposes and has been extensively studied for its efficacy in identifying epitopes and recombinant allergens. The RFC2 antibody can be conjugated with alkaline phosphatase or used as part of polyclonal antibodies for various applications. Additionally, it can serve as a protein kinase inhibitor, targeting specific kinases involved in signaling pathways. Its versatility makes it an essential tool for studying protein-protein interactions, drug discovery, and analyzing food extracts for specific polypeptide sequences.</p>

<p>AGTRAP antibody was raised in Rabbit using Human AGTRAP as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of HEATR4 antibody, catalog no. 70R-4280</p>

<p>DDIT4L antibody was raised using the middle region of DDIT4L corresponding to a region with amino acids KLGCSKVLVPEKLTQRIAQDVLRLSSTEPCGLRGCVMHVNLEIENVCKKL</p>

<p>Rabbit Polyclonal HDAC1 antibody (Ser421/423)</p>

<p>Rabbit polyclonal PSME3 antibody (FITC)</p>

<p>EphB6 antibody was raised in Mouse using a purified recombinant fragment of EphB6(aa601-750) expressed in E. coli as the immunogen.</p>

<p>The CA 15-3 antibody is a highly effective tool for detecting and measuring the levels of CA 15-3 antigen in biological samples. This monoclonal antibody specifically targets the CA 15-3 antigen, which is a glycoprotein commonly found on the surface of breast cancer cells. By binding to this antigen, the CA 15-3 antibody enables researchers and clinicians to identify and monitor the progression of breast cancer.</p>

<p>1-154 amino acids: MGSSHHHHHH SSGLVPRGSH MPRRAENWDE AEVGAEEAGV EEYGPEEDGG EESGAEESGP EESGPEELGA EEEMEAGRPR PVLRSVNSRE PSQVIFCNRS PRVVLPVWLN FDGEPQPYPT LPPGTGRRIH SYRGHLWLFR DAGTHDGLLV NQTELFVPSL NVDGQPIFAN ITLP</p>

<p>Rat monoclonal IFN gamma antibody (biotin)</p>

<p>Rabbit polyclonal SHPTP2 antibody</p>

<p>PSCD4 antibody was raised using the N terminal of PSCD4 corresponding to a region with amino acids NKTAIGTYLGERDPINLQVLQAFVDCHEFANLNLVQALRQFLWSFRLPGE</p>

<p>Oxazepam Conjugate for use in immunoassays</p>

<p>Rabbit polyclonal RE57611p antibody</p>

<p>HBcAg antibody is a monoclonal antibody that specifically targets the Hepatitis B core antigen (HBcAg). This antibody has been extensively used in various research studies and diagnostic applications in the field of life sciences. HBcAg is an important marker for the diagnosis and monitoring of Hepatitis B virus (HBV) infection.</p>

<p>ABRA antibody was raised in rabbit using the middle region of ABRA as the immunogen</p>

<p>The SHARPIN antibody is a powerful tool used in the field of Life Sciences and industrial research. It is specifically designed to target microvessel endothelial cells and inhibit angiogenesis, the process of forming new blood vessels. This antibody can be utilized as both an inhibitor and a therapeutic agent for various applications.</p>

<p>GPX3 antibody was raised using a synthetic peptide corresponding to a region with amino acids DCHGGISGTIYEYGALTIDGEEYIPFKQYAGKYVLFVNVASYUGLTGQYI</p>

<p>The TH antibody is a neuroprotective antibody that targets tyrosine hydroxylase (TH), an enzyme involved in the synthesis of dopamine. It specifically recognizes and binds to various isoforms of 14-3-3 proteins when they are activated. This antibody has been extensively used in Life Sciences research for its ability to detect and quantify TH levels in different tissues and cell types.</p>

<p>ASB17 antibody was raised using the middle region of ASB17 corresponding to a region with amino acids SPLSGITPLFYVAQTRQSNIFKILLQYGILEREKNPINIVLTIVLYPSRV</p>

<p>Rabbit polyclonal Girdin antibody (Ser1417)</p>

<p>Purified recombinant MX2 protein (His tag)</p>

<p>Laminin Gamma 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GYHVKTEDPDLRTSSWIKQFDTSRFHPQDLSRSQKCIRKEGSSEISQRVQ</p>

<p>GPR1 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>ZMIZ1 antibody was raised in rabbit using the N terminal of ZMIZ1 as the immunogen</p>

<p>Mouse monoclonal CD45.2 antibody (FITC)</p>

<p>Purified recombinant SPN protein (His tag)</p>

<p>Mouse monoclonal PVRL1 antibody</p>

<p>MAOA antibody was raised using the middle region of MAOA corresponding to a region with amino acids NINVTSEPHEVSALWFLWYVKQCGGTTRIFSVTNGGQERKFVGGSGQVSE</p>

<p>LXN antibody was raised in Rabbit using Human LXN as the immunogen</p>

<p>The APRIL antibody is a growth factor that plays a crucial role in endothelial growth and low-density lipoprotein (LDL) glycation. It is widely used in the field of Life Sciences for research purposes. This antibody specifically targets APRIL, which is a member of the tumor necrosis factor (TNF) superfamily. By binding to APRIL, this antibody inhibits its activity and prevents its interaction with other receptors.</p>

<p>Rabbit Polyclonal NFkB p105/p50 antibody (Ser893)</p>

<p>ZNF562 antibody was raised in rabbit using the middle region of ZNF562 as the immunogen</p>

<p>GNAZ antibody was raised using a synthetic peptide corresponding to a region with amino acids LIIYNAIDSLTRIIRALAALRIDFHNPDRAYDAVQLFALTGPAESKGEIT</p>

<p>ALG2 antibody was raised using a synthetic peptide corresponding to a region with amino acids QSDLGQYVTFLRSFSDKQKISLLHSCTCVLYTPSNEHFGIVPLEAMYMQC</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an effective antituberculosis drug belonging to the class of rifamycins. It is specifically designed to combat tuberculosis infection and contains active compounds that exhibit bactericidal activity. By binding to DNA-dependent RNA polymerase, this drug prevents transcription and replication, effectively inhibiting bacterial growth. Additionally, it has been extensively tested using a patch-clamp technique on human erythrocytes, confirming its high frequency of human activity. The metabolization process involves various transformations such as hydrolysis, oxidation, reduction, and conjugation with glucuronic acid. Rifapentine also selectively targets markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>Purified recombinant QDPR protein</p>

<p>TKT antibody was raised using a synthetic peptide corresponding to a region with amino acids ESYHKPDQQKLQALKDTANRLRISSIQATTAAGSGHPTSCCSAAEIMAVL</p>

<p>Rec8 antibody was raised using a synthetic peptide corresponding to a region with amino acids QLQIGVIRVYSQQCQYLVEDIQHILERLHRAQLQIRIDMETELPSLLLPN</p>

<p>1-362 amino acids: MGSSHHHHHH SSGLVPRGSH MSDEGSRGSR LPLALPPASQ GCSSGGGGGG GGGSSAGGSG NSRPPRNLQG LLQMAITAGS EEPDPPPEPM SEERRQWLQE AMSAAFRGQR EEVEQMKSCL RVLSQPMPPT AGEAEQAADQ QEREGALELL ADLCENMDNA ADFCQLSGMH LLVGRYLEAG AAGLRWRAAQ LIGTCSQNVA AIQEQVLGLG ALRKLLRLLD RDACDTVRVK ALFAISCLVR EQEAGLLQFL RLDGFSVLMR AMQQQVQKLK VKSAFLLQNL LVGHPEHKGT LCSMGMVQQL VALVRTEHSP FHEHVLGALC SLVTDFPQGV RECREPELGL EELLRHRCQL LQQHEEYQEE LEFCEKLLQT CFSSPADDSM DR</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CYP2E1 antibody, catalog no. 70R-7499</p>

<p>FAM175A antibody was raised in Rabbit using Human FAM175A as the immunogen</p>

<p>POLR3C antibody was raised in rabbit using the middle region of POLR3C as the immunogen</p>

<p>DYNC2LI1 antibody was raised in Rabbit using Human DYNC2LI1 as the immunogen</p>

<p>Purified Polyclonal 14 3 3 eta antibody</p>

<p>Purified Polyclonal MKK1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of EWSR1 antibody, catalog no. 70R-8266</p>

<p>Purified Rabbit polyclonal PUB69 antibody</p>

<p>The FOXP1 antibody is a highly effective and versatile tool used in Life Sciences research. It is a polyclonal antibody that specifically targets the FOXP1 protein, which plays a crucial role in various cellular processes. This antibody binds to the nuclear-activated FOXP1 protein, allowing for its detection and analysis.</p>

<p>Purified Polyclonal hOCT2 antibody</p>

<p>FOXO6 antibody was raised in rabbit using the N terminal of FOXO6 as the immunogen</p>

<p>CKMB antibody was raised in mouse using purified human CK-MB as the immunogen.</p>

<p>NPFFR2 antibody was raised in rabbit using the C terminal of NPFFR2 as the immunogen</p>

<p>The Myoglobin antibody is a highly specific and effective tool used in spectrometric and electrode-based assays. This Monoclonal Antibody has been developed to target the myoglobin protein, which plays a crucial role in oxygen storage and transport in muscle tissues. The Myoglobin antibody has been extensively tested and proven to have neutralizing properties against myoglobin, making it an ideal choice for research studies involving myoglobin-related processes.</p>