Prodotti biochimici e reagenti

<p>PDK3 antibody was raised using the middle region of PDK3 corresponding to a region with amino acids IYLKALSSESFERLPVFNKSAWRHYKTTPEADDWSNPSSEPRDASKYKAK</p>

<p>LRRC24 antibody was raised using the N terminal of LRRC24 corresponding to a region with amino acids PLAALRRLYLHNNSLRALEAGAFRAQPRLLELALTSNRLRGLRSGAFVGL</p>

<p>IRS1 antibody was raised in Rabbit using Human IRS1 as the immunogen</p>

<p>KIAA0692 antibody was raised using the middle region of Kiaa0692 corresponding to a region with amino acids CYSPSDRQSWPSPAVKGRFKSQLPDLSGPHSYSPGRNSVAGSNPAKPGLG</p>

<p>Rabbit polyclonal TCEAL3 antibody</p>

<p>The Albumin antibody is a powerful tool for researchers working with human albumin. This monoclonal antibody specifically targets and binds to albumin, allowing for precise detection and analysis. It can be used in various applications, including immunohistochemistry, Western blotting, and ELISA.</p>

<p>Purified Polyclonal GRLF1 antibody</p>

<p>Rabbit polyclonal NFKB1 antibody (biotin)</p>

<p>Rabbit polyclonal TAC1 antibody</p>

<p>Purified Polyclonal cJun antibody</p>

<p>AZD9977 is a peptide that has been shown to inhibit the activity of a number of proteins, including protein interactions, activator and ligand. It is also an inhibitor for CAS No. 1850385-64-6 and has been shown to be a research tool for studying the function of ion channels and receptors. The antibody has been used to study the localization of ion channels in rat hippocampal neurons. AZD9977 is also an inhibitor for CAS No. 1850385-64-6 with high purity and is a useful reagent for life sciences as well as high quality research tools.</p>

<p>Rabbit polyclonal CSFR antibody (Tyr809)</p>

<p>Mouse monoclonal HSPA6 antibody</p>

<p>Purified Polyclonal TNFAIP1 antibody</p>

<p>ANTXR1 antibody was raised using the middle region of ANTXR1 corresponding to a region with amino acids VRWGEKGSTEEGAKLEKAKNARVKMPEQEYEFPEPRNLNNNMRRPSSPRK</p>

<p>Mouse monoclonal HLADQ antibody</p>

<p>1-339 amino acids: MRGSHHHHHH GMASMTGGQQ MGRDLYDDDD KDRWGSHMST VHEILCKLSL EGDHSTPPSA YGSVKAYTNF DAERDALNIE TAIKTKGVDE VTIVNILTNR SNAQRQDIAF AYQRRTKKEL ASALKSALSG HLETVILGLL KTPAQYDASE LKASMKGLGT DEDSLIEIIC SRTNQELQEI NRVYKEMYKT DLEKDIISDT SGDFRKLMVA LAKGRRAEDG SVIDYELIDQ DARDLYDAGV KRKGTDVPKW ISIMTERSVP HLQKVFDRYK SYSPYDMLES IRKEVKGDLE NAFLNLVQCI QNKPLYFADR LYDSMKGKGT RDKVLIRIMV SRSEVDMLKI RSEFKRKYGK SLYYYIQQDT KGDYQKALLY LCGGDD</p>

<p>Purified recombinant PHGDH protein (His tag)</p>

<p>Purified recombinant RPL26L1 protein (His tag)</p>

<p>The SQSTM1 antibody is a monoclonal antibody that specifically targets and binds to SQSTM1 protein. This protein plays a crucial role in various cellular processes, including macrophage inflammatory responses, antigen presentation, and autophagy regulation. The SQSTM1 antibody can be used in bioassays to detect and measure the levels of SQSTM1 protein in different samples.</p>

<p>UBE2K antibody was raised using a synthetic peptide corresponding to a region with amino acids QTARLWAHVYAGAPVSSPEYTKKIENLCAMGFDRNAVIVALSSKSWDVET</p>

<p>BCAS2 antibody was raised using the N terminal of BCAS2 corresponding to a region with amino acids MAGTGLVAGEVVVDALPYFDQGYEAPGVREAAAALVEEETRRYRPTKNYL</p>

<p>RBPJ antibody is a highly specific and potent inhibitor of the RBPJ protein. RBPJ is a transcription factor that plays a crucial role in various cellular processes, including development, differentiation, and immune response. This antibody binds to RBPJ with high affinity, preventing its interaction with DNA and inhibiting its transcriptional activity.</p>

<p>Clenbuterol OVA is a unique product in the field of Life Sciences. It is a mitochondrial superoxide that has been conjugated with Hapten to create a powerful cell antigen. This reactive compound can be used in various research applications, and its properties have been extensively studied. Clenbuterol OVA is recognized by a specific monoclonal antibody, which has neutralizing capabilities. Researchers can utilize this product for the development of Proteins and Antigens, as well as for studying electrode growth factors and chemokines. Additionally, Clenbuterol OVA has shown promising results in hepatocyte growth studies. With its high specificity and reliability, this product is an essential tool for any researcher in the field.</p>

<p>Rabbit polyclonal rPSB antibody (biotin)</p>

<p>Purified recombinant RHOV protein (His tag)</p>

<p>Purified Polyclonal CD167a antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF431 antibody, catalog no. 70R-8406</p>

<p>Chlamydia trachomatis antibody was raised in goat using L2 and other serovar groups as the immunogen.</p>

<p>Purified recombinant FHL3 protein (His tag)</p>

<p>The CrkL antibody is an essential tool in the field of Life Sciences. It is a versatile antibody that can be used for various applications, such as research and diagnostics. This antibody specifically targets CrkL, a protein known to play a crucial role in cell signaling pathways.</p>

<p>Mouse monoclonal Benzoylecgonine/Cocaine antibody</p>

<p>Rabbit polyclonal ZAP70 antibody (Tyr315)</p>

<p>This antibody reacts with heavy (gamma) chains on rat IgG and light chains on all rat immunoglobulins.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RAVER2 antibody, catalog no. 70R-4637</p>

<p>C21ORF13 antibody was raised using a synthetic peptide corresponding to a region with amino acids GSEEPLQSKESHPLPPSQASTSHAFGDSKVTVVNSIKPSSPTEGKRKIII</p>

<p>Purified recombinant HS3ST1 protein (His tag)</p>

<p>Purified Polyclonal NGEP antibody</p>

<p>Mouse monoclonal RASSF1 antibody</p>

<p>CCDC25 antibody was raised using the middle region of CCDC25 corresponding to a region with amino acids DLAAEKECRDREERNEKKAQIQEMKKREKEEMKKKREMDELRSYSSLMKV</p>

<p>The Phytase antibody is a Monoclonal Antibody that is used in various applications in the Life Sciences field. It is produced by hybridoma cells and has been extensively studied for its antigen-antibody reaction properties. This antibody can be used in assays to detect and quantify phytase, an enzyme that plays a crucial role in the breakdown of phytic acid, a compound found in plants.</p>

<p>The Nestin antibody is a monoclonal antibody used in Life Sciences research. It specifically targets Nestin, a protein that is highly expressed in cells of the central nervous system during development and in certain types of tumors. This antibody has been shown to have a high affinity for Nestin and can be used for various applications, including immunohistochemistry and Western blotting. Additionally, studies have indicated that the Nestin antibody may have therapeutic potential in the treatment of certain diseases, such as cancer and neurodegenerative disorders. Its ability to inhibit tumor growth and induce apoptosis makes it a promising candidate for further research and development.</p>

<p>The TRPC6 antibody is a highly specialized product in the field of Life Sciences. It belongs to the category of Polyclonal Antibodies and has various applications in research and diagnostics. This antibody specifically targets TRPC6, which is a fatty acid-activated cation channel involved in numerous physiological processes.</p>

<p>Mouse monoclonal KCNJ3 antibody</p>

<p>PRKAB1 antibody was raised using the N terminal of PRKAB1 corresponding to a region with amino acids KILMDSPEDADLFHSEEIKAPEKEEFLAWQHDLEVNDKAPAQARPTVFRW</p>

<p>NDUFS3 antibody was raised using the middle region of NDUFS3 corresponding to a region with amino acids EVKRVVAEPVELAQEFRKFDLNSPWEAFPVYRQPPESLKLEAGDKKPDAK</p>

<p>The metabolite of furazolidone-OVA</p>

<p>Mouse monoclonal GRIA3 antibody</p>

<p>Purified recombinant NBL1 protein (His tag)</p>

<p>ZNF286 antibody was raised in rabbit using the N terminal of ZNF286 as the immunogen</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections as it contains active compounds with bactericidal activity. This drug works by inhibiting bacterial growth through its binding to DNA-dependent RNA polymerase, thus preventing transcription and replication. Its efficacy has been confirmed through extensive research using the patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>Mouse RBC antibody (FITC) was raised in rabbit using mouse erythrocytes as the immunogen.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication of bacteria. Its efficacy has been demonstrated through extensive research using advanced techniques such as transcription-quantitative polymerase chain and patch-clamp technique. The metabolism of this drug involves various transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome p450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains, inhibiting their growth in culture.</p>

<p>SLC37A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LKIPGVIEFSLCLLFAKLVSYTFLFWLPLYITNVDHLDAKKAGELSTLFD</p>

<p>Rabbit polyclonal BCAS2 antibody</p>

<p>PTK7 antibody was raised in Mouse using a purified recombinant fragment of human PTK7 expressed in E. coli as the immunogen.</p>

<p>The ARNT antibody is a valuable tool in the field of Life Sciences. It is widely used for transfer reactions and immunoassays. This antibody specifically targets anti-VEGF (Vascular Endothelial Growth Factor) and is available in both polyclonal and monoclonal forms. The ARNT antibody can be utilized for various applications, including Western blotting, immunohistochemistry, and immunofluorescence.</p>

<p>Mouse monoclonal HBV Pres 1 antibody</p>

<p>Rabbit polyclonal VATPase G1 antibody (HRP)</p>

<p>SNX7 antibody was raised using the middle region of SNX7 corresponding to a region with amino acids LDSKVEVLTYKKADTDLLPEEIGKLEDKVECANNALKADWERWKQNMQND</p>

<p>KHSRP antibody was raised using the middle region of KHSRP corresponding to a region with amino acids WEEYYKKQAQVATGGGPGAPPGSQPDYSAAWAEYYRQQAAYYGQTPGPGG</p>

<p>Rabbit polyclonal OR13H1 antibody</p>

<p>Mouse monoclonal ARHGAP25 antibody</p>

<p>UNC45A antibody was raised using a synthetic peptide corresponding to a region with amino acids REIASTLMESEMMEILSVLAKGDHSPVTRAAAACLDKAVEYGLIQPNQDG</p>

<p>ICK antibody was raised in Rabbit using Human ICK as the immunogen</p>

<p>Purified Polyclonal Cathepsin V antibody</p>

<p>Recombinant Human LZTFL1 protein (His tag)</p>

<p>Purified recombinant DTD2 protein (His tag)</p>

<p>The LSD antibody is a high-quality polyclonal antibody used in Life Sciences research. It exhibits high specificity for collagen and alpha-fetoprotein, making it an ideal tool for studying these proteins. This antibody has been extensively tested and validated using human serum samples, ensuring its reliability and accuracy in various experimental settings. With its low density and high specific activity, the LSD antibody enables precise detection of target molecules with minimal background interference. It can be used in a wide range of applications, including immunoassays, Western blotting, ELISA, and immunohistochemistry. Whether you are studying glycan structures, lipoprotein lipase activity, or chimeric proteins, the LSD antibody is an indispensable tool for your research needs. Trust in its exceptional performance and unlock new insights into complex biological processes.</p>

<p>Peptide H-DRV^YIHPFHL-OH is a heavy labelled form of Angiotensin I peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>LETM1 antibody was raised in Rabbit using Human LETM1 as the immunogen</p>

<p>Purified Polyclonal GSK3 alpha/beta antibody</p>

<p>CMV ICP36 antibody was raised in mouse using cytomegalovirus major DNA binding protein ICP36 as the immunogen.</p>

<p>Mouse monoclonal OSBPL11 antibody</p>

<p>Please enquire for more information about 1,2-Dipalmitoyl-3-octanoyl-rac-glycerol including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>PHENCYCLIDINE- BOVINE SERUM ALBUMIN(PCP-BSA) CONJUGATE</p>

<p>Mouse monoclonal CELF1 antibody</p>

<p>BMX antibody was raised in Mouse using a purified recombinant fragment of human BMX expressed in E. coli as the immunogen.</p>

<p>Hepatitis C Virus antibody was raised in goat using recombinant polypeptide containing core with NS3 and NS4 regions as the immunogen.Goats are US origin</p>

<p>Purified native Porcine Thrombin protein</p>

<p>TCS HDAC6 20b is a histone deacetylase (HDAC) inhibitor that is used in the treatment of chronic obstructive pulmonary disease. TCS HDAC6 20b inhibits HDAC activity and acetylation of histones, leading to changes in chromatin structure and gene expression. It is also used for the treatment of silicosis, collagen diseases, and cancer. TCS HDAC6 20b has been shown to increase the production of growth factors such as erythropoietin in mammalian cells. This drug also reduces DNA methylation by inhibiting the enzyme DNA methyltransferase.</p>

<p>Rat monoclonal CD11b antibody (FITC)</p>

<p>GNB2 antibody was raised in Rabbit using Human GNB2 as the immunogen</p>

<p>HEPACAM antibody was raised using the N terminal of HEPACAM corresponding to a region with amino acids LLLSDLQLADEGTYEVEISITDDTFTGEKTINLTVDVPISRPQVLVASTT</p>

<p>Purified recombinant PDLIM1 protein (His tag)</p>

<p>LIX antibody was raised in rabbit using highly pure recombinant murine LIX as the immunogen.</p>

<p>ZBTB16 antibody was raised in Mouse using a purified recombinant fragment of human ZBTB16 expressed in E. coli as the immunogen.</p>

<p>Rabbit polyclonal Lyn antibody (Tyr507)</p>

<p>Rabbit polyclonal CIB2 antibody</p>

<p>LMAN2 antibody was raised using the N terminal of LMAN2 corresponding to a region with amino acids SLIKPYQGVGSSSMPLWDFQGSTMLTSQYVRLTPDERSKEGSIWNHQPCF</p>

<p>Rabbit polyclonal USO1 antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds with bactericidal activity. This drug inhibits bacterial growth by binding to DNA-dependent RNA polymerase, thus preventing transcription and replication. Its efficacy has been demonstrated through extensive testing using the patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>OR2M2 antibody was raised in rabbit using the C terminal of OR2M2 as the immunogen</p>

<p>PCDHGC3 antibody was raised using the N terminal of PCDHGC3 corresponding to a region with amino acids ISEAVAPGTRFPLESAHDPDVGSNSLQTYELSRNEYFALRVQTREDSTKY</p>

<p>Rabbit polyclonal CXCR4 antibody (Ser339)</p>

<p>Mucolipin 1 antibody was raised using the N terminal of MCOLN1 corresponding to a region with amino acids FRHLFLLGYSDGADDTFAAYTREQLYQAIFHAVDQYLALPDVSLGRYAYV</p>

<p>BSA antibody was raised in mouse using BSA as the immunogen.</p>

<p>Rabbit polyclonal CDC25B antibody (Ser353)</p>

<p>IMP3 antibody was raised using a synthetic peptide corresponding to a region with amino acids GHVRVGPDVVTDPAFLVTRSMEDFVTWVDSSKIKRHVLEYNEERDDFDLE</p>

<p>HABP2 antibody was raised in Rabbit using Human HABP2 as the immunogen</p>