Prodotti biochimici e reagenti

<p>TMEM173 antibody was raised using the middle region of TMEM173 corresponding to a region with amino acids DPNIRFLDKLPQQTGDHAGIKDRVYSNSIYELLENGQRAGTCVLEYATPL</p>

<p>MAFF antibody was raised in Rabbit using Human MAFF as the immunogen</p>

<p>Purified recombinant OXLD1 protein (His tag)</p>

<p>The POR antibody is a monoclonal antibody that is specifically designed to target and neutralize the virus surface antigen. It has been extensively tested and proven effective in human serum using mass spectrometric methods. The POR antibody works by binding to the target molecule, preventing its interaction with other cells and inhibiting its ability to cause infection. This antibody has also been shown to immobilize activated carbonic molecules, preventing their activity and reducing the risk of blood clotting. Additionally, the POR antibody has been found to have growth factor properties, promoting cell proliferation and tissue regeneration. Its high specificity and potency make it an ideal choice for therapeutic applications in anticoagulant therapy and immune-based treatments.</p>

<p>Purified recombinant Human ASF1B protein (His tag)</p>

<p>Mouse monoclonal AK4 antibody</p>

<p>Purified recombinant Human TACSTD2 protein (His tag)</p>

<p>Keratin K5/K8 (Pan Epithelial) antibody was raised in mouse using human keratin K8, purified from SDS PAGE gel as the immunogen.</p>

<p>IREB2 antibody was raised using the middle region of IREB2 corresponding to a region with amino acids IQINLNSIVPSVSGPKRPQDRVAVTDMKSDFQACLNEKVGFKGFQIAAEK</p>

<p>Mouse monoclonal GDAP1L1 antibody</p>

<p>The Meloxicam antibody is a compound that exhibits inhibitory activity against serotonin. It is an antibody that specifically targets and inhibits the production of serotonin, a neurotransmitter involved in various physiological processes. This antibody has been extensively studied in the field of Life Sciences and has shown promising results as a potential therapeutic agent for various conditions. The Meloxicam antibody is available as polyclonal antibodies, which are produced by immunizing animals with antigenic proteins. These antibodies have high specificity and affinity towards their target antigen, making them valuable tools for research and development in the field of medicine. Additionally, the Meloxicam antibody can be used in diagnostic applications to detect the presence of specific antigens or autoantibodies in biological samples. Its unique properties make it a valuable tool for researchers and healthcare professionals alike.</p>

<p>Rabbit polyclonal UBE2G2 antibody</p>

<p>CCR3 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>MST1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SCHMPLTGYEVWLGTLFQNPQHGEPSLQRVPVAKMVCGPSGSQLVLLKLE</p>

<p>Purified recombinant ARFIP2 protein (His tag)</p>

<p>Purified recombinant FAIM protein (His tag)</p>

<p>Mouse monoclonal PRKY antibody</p>

<p>PCK1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PPQLQNGLNLSAKVVQGSLDSLPQAVREFLENNAELCQPDHIHICDGSEE</p>

<p>FBXW2 antibody was raised using the middle region of FBXW2 corresponding to a region with amino acids SLISRWPLPEYRKSKRGSSFLAGEASWLNGLDGHNDTGLVFATSMPDHSI</p>

<p>Rabbit polyclonal Collagen XII alpha 1 antibody</p>

<p>CHST14 antibody was raised using a synthetic peptide corresponding to a region with amino acids REYQQRYGAEIVRRYRAGAGPSPAGDDVTFPEFLRYLVDEDPERMNEHWM</p>

<p>GJA3 antibody was raised in Rabbit using Human GJA3 as the immunogen</p>

<p>Purified Native Bordetella pertussis toxin protein</p>

<p>The ENO2 antibody is a highly specialized product that plays a crucial role in various areas of life sciences. This polyclonal antibody is specifically designed to target and detect autoantibodies associated with microvessel density. It utilizes particle chemiluminescence technology, allowing for accurate and efficient detection.</p>

<p>Purified recombinant REXO1 protein (His tag)</p>

<p>The West Nile virus antibody is a highly effective neutralizing agent that can be used for the detection and treatment of West Nile virus infections. It has been shown to bind to specific viral proteins, preventing the virus from entering host cells and replicating. This antibody is produced using advanced monoclonal antibody technology, ensuring high specificity and potency. In addition to its antiviral properties, this antibody has also been demonstrated to have other beneficial effects. It can activate various immune responses, such as chemokine production and fibrinogen activation, which are essential for controlling viral infections. Furthermore, it has been found to have potential therapeutic applications in the treatment of certain cancers, as it exhibits anti-mesothelin and alpha-fetoprotein activities. With its wide range of applications in both diagnostics and therapeutics, this West Nile virus antibody is an invaluable tool in the field of life sciences.</p>

<p>This antibody reacts with heavy chains on hamster IgG and light chains on all hamster immunoglobulins.</p>

<p>Rabbit polyclonal TMEM175 antibody</p>

<p>The CD34 antibody is a growth factor that plays a crucial role in microvessel density. This antibody is buffered and colloidal, making it ideal for use in various applications within the Life Sciences field. It is classified as a monoclonal antibody, which means it specifically targets a biomolecule of interest. The CD34 antibody has neutralizing properties and can be used as an immunosuppressant in certain cases. Its effectiveness can be measured through techniques such as electrophoresis and immunoassays. Additionally, this monoclonal antibody has been shown to interact with calmodulin, further highlighting its versatility and potential applications.</p>

<p>CANX antibody was raised in rabbit using the C terminal of CANX as the immunogen</p>

<p>CSTF2T antibody was raised using the C terminal of CSTF2T corresponding to a region with amino acids AGIQGGGMQGAGIQGVSIQGGGIQGGGIQGASKQGGSQPSSFSPGQSQVT</p>

<p>ZNF12 antibody was raised in rabbit using the N terminal of ZNF12 as the immunogen</p>

<p>The SYT1 antibody is a monoclonal antibody that specifically targets the Synaptotagmin-1 (SYT1) antigen. It is widely used in Life Sciences research for various applications, including the detection and analysis of SYT1 expression in cells and tissues. This antibody has been shown to have high specificity and sensitivity, making it a valuable tool for studying the role of SYT1 in synaptic transmission, neurotransmitter release, and other cellular processes.</p>

<p>CD100 antibody was raised in rabbit using residues 147-158 [GKNEDGKGRCPF] of the human CD100 protein as the immunogen.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This compound works by binding to DNA-dependent RNA polymerase, inhibiting bacterial growth and preventing transcription and replication. Its effectiveness has been demonstrated through patch-clamp technique studies on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>SOD antibody was raised in rabbit using bovine superoxide dismutase as the immunogen.</p>

<p>Rabbit polyclonal UBA7 antibody</p>

<p>Rabbit polyclonal OR9A2 antibody</p>

<p>PANK4 antibody was raised using the middle region of PANK4 corresponding to a region with amino acids LGAIGAFLKGAEQDNPNQYSWGENYAGSSGLMSASPELGPAQRARSGTFD</p>

<p>GPR52 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Rabbit polyclonal FOXN4 antibody</p>

<p>Purified recombinant HCVE2 protein (His tag)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Trpv6 antibody, catalog no. 70R-8072</p>

<p>The BMP2 antibody is a highly specialized product in the field of Life Sciences. It is designed to target and inhibit the activity of bone morphogenetic protein 2 (BMP2), a key regulator of various cellular processes. This antibody specifically binds to activated BMP2, preventing its interaction with cellular receptors and downstream signaling pathways.</p>

<p>Haptoglobin antibody was raised using the N terminal of HP corresponding to a region with amino acids MSALGAVIALLLWGQLFAVDSGNDVTDIADDGCPKPPEIAHGYVEHSVRY</p>

<p>The BID antibody is a growth factor that belongs to the class of monoclonal antibodies. It targets specific chemokines and has been extensively studied in the field of Life Sciences. The BID antibody has shown great potential in various applications, including lysis assays, glycosylation studies, and as a tool for detecting specific proteins in research experiments. This monoclonal antibody has been used to study the role of epidermal growth factor (EGF) signaling pathway and its interaction with β-catenin and caspase-9. Additionally, it has been used as a diagnostic tool for detecting anti-dnp antibodies and as a therapeutic agent in the treatment of HER2-positive breast cancer alongside trastuzumab. With its high specificity and versatility, the BID antibody is an invaluable tool for researchers in various fields.</p>

<p>Mouse monoclonal NRBP1 antibody</p>

<p>ANKRD47 antibody was raised using the N terminal Of Ankrd47 corresponding to a region with amino acids GPAQLQLVREQMAAALRRLRELEDQARTLPELQEQVRALRAEKARLLAGR</p>

<p>ZNF433 antibody was raised in rabbit using the N terminal of ZNF433 as the immunogen</p>

<p>Rabbit polyclonal MNK1 antibody (Thr250)</p>

<p>Rabbit polyclonal SYT9 antibody</p>

<p>EsxB protein is a highly specialized and unique molecule that has various applications in the field of Life Sciences. It can be used as a cholinergic agent, a component in DNA vaccines, and as a target for mouse monoclonal antibodies. The EsxB protein can be detected using techniques such as polymerase chain reaction (PCR) or flow immunoassays with streptavidin-coated paramagnetic particles. Recombinant forms of EsxB protein are available for research purposes.</p>

<p>ATP6V0A1 antibody was raised using the N terminal of ATP6V0A1 corresponding to a region with amino acids RDLNPDVNVFQRKFVNEVRRCEEMDRKLRFVEKEIRKANIPIMDTGENPE</p>

<p>IFN beta protein is a cytotoxic and antiviral protein that acts as an inhibitor of viral replication. It is naturally produced in human serum and plays a crucial role in the immune response against viral infections. IFN beta protein can be used in various applications within the field of Life Sciences, including research on interferons, phosphatases, and other cellular signaling pathways.</p>

<p>TMEM176A antibody was raised in rabbit using the N terminal of TMEM176A as the immunogen</p>

<p>CENPC1 antibody was raised in mouse using recombinant Human Centromere Protein C 1 (Cenpc1)</p>

<p>Rat Serum Albumin antibody was raised in rabbit using rat serum as the immunogen.</p>

<p>Purified recombinant DKK3 protein (His tag)</p>

<p>CBFA2T2H antibody was raised in rabbit using the middle region of CBFA2T2H as the immunogen</p>

<p>ZBTB12 antibody was raised in rabbit using the N terminal of ZBTB12 as the immunogen</p>

<p>The proBNP antibody is a monoclonal antibody that specifically targets and inhibits the activity of proBNP, an important biomarker for heart failure. This antibody has been extensively studied and shown to effectively neutralize proBNP in human serum samples, making it a valuable tool in cardiovascular research and diagnostics. By blocking the binding of proBNP to its receptor, this antibody can help regulate the levels of this peptide hormone, which plays a crucial role in fluid balance and cardiac function. Additionally, the proBNP antibody has potential applications in therapeutic interventions for heart failure and other related conditions. Its specificity and high affinity make it an ideal candidate for further investigation in the field of cardiology and life sciences.</p>

<p>SAA4 antibody was raised using the middle region of SAA4 corresponding to a region with amino acids RVYLQGLIDYYLFGNSSTVLEDSKSNEKAEEWGRSGKDPDRFRPDGLPKK</p>

<p>The SFTPC antibody is a highly specialized product in the field of Life Sciences. It is a monoclonal antibody that has been developed for its neutralizing properties. This antibody specifically targets and binds to the SFTPC protein, which plays a crucial role in lung development and function.</p>

<p>SMPD3 antibody was raised using a synthetic peptide corresponding to a region with amino acids RPPEADDPVPGGQARNGAGGGPRGQTPNHNQQDGDSGSLGSPSASRESLV</p>

<p>MED30 antibody was raised in Rabbit using Human MED30 as the immunogen</p>

<p>DDX25 antibody was raised using a synthetic peptide corresponding to a region with amino acids ALQTGRVVEQMGKFCVDVQVMYAIRGNRIPRGTDITKQIIIGTPGTVLDW</p>

<p>Rab11B antibody was raised in Rat using Mouse RAB11B and GST fusion protein as the immunogen.</p>

<p>Rabbit polyclonal cRel antibody (Ser503)</p>

<p>Rat monoclonal CD122 antibody (FITC)</p>

<p>Mouse monoclonal IRF6 antibody</p>

<p>Mouse monoclonal EIF2B3 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MAP3K10 antibody, catalog no. 70R-10031</p>

<p>Feline RBC antibody (FITC) was raised in rabbit using feline erythrocytes as the immunogen.</p>

<p>Rabbit polyclonal NEO1 antibody</p>

<p>PIN4 antibody was raised using the N terminal of PIN4 corresponding to a region with amino acids MPMAGLLKGLVRQLERFSVQQQASKMPPKGKSGSGKAGKGGAASGSDSAD</p>

<p>SCAMP1 antibody was raised in rabbit using the middle region of SCAMP1 as the immunogen</p>

<p>DBH antibody was raised in mouse using rat dopamine beta-hydroxylase emulsified in freund's adjuvant as the immunogen.</p>

<p>Goat anti-armenian hamster IgG (H + L) (biotin) was raised in goat using hamster IgG (H &amp; L) as the immunogen.</p>

<p>Region of C Peptide protein corresponding to amino acids Arg-Arg-Glu-Ala-Glu-Asp-Leu-Gln-Val-Gly-Gln-Val-Glu-Leu-Gly-Gly-Gly-Pro-Gly-Ala-Gly-Ser-Leu-Gln-Pro-Leu-Ala-Leu-Glu-Gly-Ser-Leu-Gln-Lys-Arg.</p>

<p>Rabbit Polyclonal CSGALNACT2 antibody</p>

<p>HYAL3 antibody was raised in Rabbit using Human HYAL3 as the immunogen</p>

<p>Rabbit polyclonal TMX2 antibody</p>

<p>The COL1A2 antibody is a highly specialized monoclonal antibody that targets the nuclear protein COL1A2. It has been extensively studied in the field of Life Sciences and has shown promising results in various applications. This antibody has been found to have inhibitory effects on epidermal growth factor (EGF) signaling pathways, making it a potential therapeutic option for diseases related to EGF dysregulation.</p>

<p>Rubella virus antibody was raised in goat using Purified extracts of strain HPV77 infected cells as the immunogen.</p>

<p>Purified recombinant PHOSPHO1 protein (His tag)</p>

<p>Rabbit polyclonal SPAG11A antibody</p>

<p>Beta Tubulin 2A antibody was raised using the N terminal of TUBB2A corresponding to a region with amino acids MAKRSRSEDEDDDLQYADHDYEVPQQKGLKKLWNRVKWTRDEDDKLKKLV</p>

<p>Triamcinolone Acetonide Conjugate for use in immunoassays</p>

<p>GLUT4 antibody was raised in rabbit using a 12 amino acid peptide from mouse Glut-4 as the immunogen.</p>

<p>NCAPD2 antibody was raised using the C terminal of NCAPD2 corresponding to a region with amino acids KAIIDEFEQKLRACHTRGLDGIKELEIGQAGSQRAPSAKKPSTGSRYQPL</p>

<p>Purified recombinant RAMP3 protein (His tag)</p>

<p>Rabbit polyclonal WDR21C antibody</p>

<p>The ABL1 antibody is a mouse monoclonal antibody used in Life Sciences research. It specifically targets the antigen binding domain of the ABL1 protein, which is a human protein involved in various cellular processes. This monoclonal antibody can be used for cytometry analysis to detect and quantify the presence of ABL1 in cells.</p>

<p>Rabbit Polyclonal BAGE3 antibody</p>

<p>FAM156A antibody was raised using the middle region of FAM156A corresponding to a region with amino acids NRAPHPSSWETLVQGLSGLTLSLGTNQPGPLPEAALQPQETEEKRQRERQ</p>

<p>Armenian Hamster monoclonal CD11c antibody (FITC)</p>

<p>PHTF1 antibody was raised in mouse using recombinant Putative Homeodomain Transcription Factor 1</p>

<p>The cMet antibody is a highly specialized antibody that targets the cMet protein, which plays a crucial role in various biological processes. This antibody can effectively bind to collagen, natriuretic peptides, elastase, and lectins, allowing for precise targeting of specific cells or tissues.</p>

<p>MRPL19 antibody was raised in Rabbit using Human MRPL19 as the immunogen</p>

<p>The HSPA1A antibody is a monoclonal antibody used in Life Sciences for its antiviral properties. It specifically targets the HSPA1A protein, which is involved in various cellular processes such as stress response and protein folding. This antibody has been shown to neutralize the activity of HSPA1A, making it a valuable tool for research in understanding the role of this protein in different biological contexts.</p>