Prodotti biochimici e reagenti

<p>Rabbit polyclonal Transferrin antibody (HRP)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CPNE1 antibody, catalog no. 70R-1407</p>

<p>TRIM54 antibody was raised using the N terminal of TRIM54 corresponding to a region with amino acids NFTVGFKPLLGDAHSMDNLEKQLICPICLEMFSKPVVILPCQHNLCRKCA</p>

<p>Rabbit polyclonal GPR107 antibody</p>

<p>Mouse monoclonal IRF2 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF766 antibody, catalog no. 70R-8882</p>

<p>Mouse monoclonal CST4 antibody</p>

<p>The GRIA1 antibody is a therapeutically valuable reagent that specifically targets the DNA double-strand of the GRIA1 gene. It is an extracellular antibody that can be used to test the efficacy of various compounds in inhibiting the activity of GRIA1. This antibody is particularly useful in pluripotent stem cell research, as it can help identify and isolate cells with high affinity for specific ligands. Additionally, the GRIA1 antibody can be utilized in immunohistochemical studies to visualize and analyze the expression of GRIA1 protein in different tissues and cell types. With its applications in Life Sciences and Monoclonal Antibodies, this antibody plays a crucial role in unraveling the interstitial functions of GRIA1 and advancing our understanding of pluripotent stem cells.</p>

<p>The ARF6 antibody is a cation that belongs to the group of polyclonal antibodies. It is derived from human serum albumin and is commonly used in life sciences research. This antibody specifically targets the epidermal growth factor (EGF) and has neutralizing properties against this growth factor. The ARF6 antibody can be used in various immunoassays to detect and quantify EGF-like molecules, such as chemokines, in biological samples. Its high affinity for human serum albumin ensures optimal binding and detection sensitivity. Researchers rely on the ARF6 antibody to accurately measure the levels of EGF and related molecules in their experiments.</p>

<p>Glutamate Dehydrogenase (GDH, L-GDH, GDH1, NAD(P)+ GDH1, mitochondrial Glutamate dehydrogenase 1, systemic name L-Glutamate:NAD(P)+ oxidoreductase, Cas No [9029-12-3], EC 1.4.1.4) is an enzyme that catalyzes the following reaction:   L-glutamate + H2O + NADP+ ⇌ α-ketoglutarate + NH4+ + NADPH   One unit of Glutamate Dehydrogenase will catalyze the oxidation of 1.0 μmol of NADH and the reductive amination of one micromole of alpha-ketoglutarate per minute at pH 7.95 and 37°C  in the presence of ADP. Bovine liver Glutamate Dehydrogenase is supplied in lyophilized form as a tan powder. It was lyophilized from sodium citrate and mannitol buffer, the activity is ≥15U/mg solid, specific activity ≥20U/mg protein. Store at -20°C on arrival.NADP+ is available here and NADPH is available here, depending on whether you require the reaction to proceed from left to right or from right to left, respectively.</p>

<p>Rabbit Polyclonal OR1N1 antibody</p>

<p>Slc12a5 antibody was raised in rabbit using the N terminal of Slc12a5 as the immunogen</p>

<p>Rabbit polyclonal NCK2 antibody</p>

<p>The MMP1 antibody is a powerful tool used in Life Sciences research. It is an antibody that specifically targets the matrix metalloproteinase 1 (MMP1), an enzyme involved in the breakdown of collagen. This antibody can be used to detect and quantify MMP1 levels in various samples, such as tissue lysates or cell culture supernatants.</p>

<p>The PIK3R2 antibody is a highly specialized antibody that belongs to the category of polyclonal antibodies. It is used in the field of life sciences to study various aspects related to hyperammonemia and antibody-drug interactions. This antibody specifically targets the PIK3R2 protein, which plays a crucial role in hormone peptide signaling pathways.</p>

<p>ISL2 antibody was raised in mouse using recombinant Human Isl Lim Homeobox 2</p>

<p>Rabbit polyclonal RAB20 antibody</p>

<p>Mouse monoclonal HA1C antibody</p>

<p>Arpp21 antibody was raised in rabbit using the N terminal of Arpp21 as the immunogen</p>

<p>SMAD6 antibody was raised in Mouse using a purified recombinant fragment of human SMAD6 expressed in E. coli as the immunogen.</p>

<p>Rabbit polyclonal Desmin antibody (Prediluted for IHC)</p>

<p>DHRSX antibody was raised in rabbit using the C terminal of DHRSX as the immunogen</p>

FKBP5 antibody was raised using the C terminal of FKBP5 corresponding to a region with amino acids CYLKLREYTKAVECCDKALGLDSANEKGLYRRGEAQLLMNEFESAKGDFE

<p>Mouse monoclonal OMP28 antibody</p>

<p>CDR2L antibody was raised in rabbit using the N terminal of CDR2L as the immunogen</p>

<p>Rabbit polyclonal TRAP1 antibody</p>

<p>Mouse monoclonal PLEK antibody</p>

<p>MAP1LC3A antibody was raised using the N terminal of MAP1LC3A corresponding to a region with amino acids MKMRFFSSPCGKAAVDPADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPV</p>

<p>Hepatitis C Virus Core Genotype-4 recombinant protein</p>

<p>The ATF2 antibody is a highly specialized product in the field of Life Sciences. It belongs to the class of Monoclonal Antibodies and is widely used for various applications. This antibody specifically targets ATF2, a transcription factor that plays a crucial role in regulating gene expression.</p>

Rabbit polyclonal STXBP2 antibody

<p>The SNCA antibody is a monoclonal antibody that specifically targets the chemokine receptor on virus surface antigens. It has been shown to interfere with the binding of interferons to these receptors, thereby inhibiting viral replication. The SNCA antibody has been extensively studied using mass spectrometric methods and has been found to have neutralizing properties against a wide range of viruses. In addition, it has been shown to activate fibrinogen in human serum, leading to an anticoagulant effect. This makes it a promising candidate for the development of antiviral therapies. With its high specificity and potent activity, the SNCA antibody is a valuable tool in life sciences research and has the potential to revolutionize the field of antiviral treatment.</p>

<p>Flt1 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>The NK1.1 antibody is a reactive chemokine that plays a crucial role in various biological processes. It acts as a reversible phosphorylation regulator for protein tyrosine kinases, which are essential for signal transduction in Life Sciences. This antibody is specifically designed to target and bind to the NK1.1 antigen, which is activated by epidermal growth factor, interferon, and mitogen-activated protein signaling pathways.</p>

<p>Rabbit polyclonal SALL2 antibody</p>

<p>Rabbit polyclonal EMX1 antibody</p>

<p>Purified recombinant DPPA3 protein (His tag)</p>

<p>BCS1L antibody was raised in Rabbit using Human BCS1L as the immunogen</p>

<p>Rabbit polyclonal TXNL1 antibody</p>

<p>HS3ST3B1 antibody was raised using a synthetic peptide corresponding to a region with amino acids AMLCVWLYMFLYSCAGSCAAAPGLLLLGSGSRAAHDPPALATAPDGTPPR</p>

<p>The USP10 antibody is a powerful tool used in Life Sciences research. It is an antibody that specifically targets and binds to the necrosis factor-related apoptosis-inducing protein, USP10. This autoantibody has been extensively studied and proven to be effective in various applications.</p>

<p>Morphine antibody was raised in mouse using morphine-BSA as the immunogen.</p>

<p>The ALDH1L1 antibody is a neutralizing protein that plays a crucial role in the growth factor signaling pathway. It is commonly used in Life Sciences research to study the functions of various growth factors. This monoclonal antibody specifically targets ALDH1L1, which is an acidic protein involved in hepatocyte growth and androgen regulation. The ALDH1L1 antibody can effectively bind to ALDH1L1 and inhibit its activity, thereby modulating cellular processes such as fibronectin production and protein complex formation. Additionally, this antibody has been shown to interact with cytochrome proteins, insulin receptors, and low-density lipoproteins. With its high specificity and potency, the ALDH1L1 antibody is an essential tool for researchers studying growth factor signaling pathways and related biological processes.</p>

<p>Rabbit polyclonal VPREB3 antibody</p>

<p>Rabbit polyclonal Alpha synuclein antibody (FITC)</p>

<p>Rabbit polyclonal ACC1 antibody (Ser80)</p>

<p>Mouse monoclonal CRYM antibody</p>

<p>The BTK antibody is a monoclonal antibody used in the field of Life Sciences. It specifically targets and inhibits Bruton's tyrosine kinase (BTK), an enzyme involved in various cellular processes. This antibody has been extensively studied and proven to be effective in blocking BTK activity, making it a valuable tool for researchers studying signal transduction pathways and immune system function.</p>

<p>The TGFBR3 antibody is a biomolecule that belongs to the class of antibodies. It acts as an inhibitor of natriuretic peptides and plays a crucial role in regulating the functions of mesenchymal stem cells. In the field of Life Sciences, this cytotoxic antibody is widely used for various applications, including nuclear staining and immunohistochemistry. Both monoclonal and polyclonal antibodies are available for targeting TGFBR3. By blocking the interaction between TGFBR3 and its ligands, such as brain natriuretic peptide, this antibody inhibits the activation of downstream signaling pathways involved in cell growth and differentiation. The reaction solution containing this antibody can be used to study the acetylation status of TGFBR3 and its impact on cellular processes.</p>

<p>Rabbit polyclonal THBS3 antibody</p>

<p>Purified Parainfluenza type 2 protein</p>

<p>The HSP25 antibody is a monoclonal antibody that specifically targets the antigen HSP25. This antibody is widely used in the field of life sciences for various applications, including research and diagnostics. The HSP25 antibody can be used to detect and quantify the levels of HSP25 in different samples, such as human serum or cell lysates. It can also be used in immunohistochemistry and immunofluorescence experiments to visualize the localization of HSP25 within cells or tissues. Additionally, this antibody has been utilized in studies investigating the role of HSP25 in various biological processes, such as its interaction with TGF-beta signaling pathways or its involvement in helicobacter infections. With its high specificity and sensitivity, the HSP25 antibody is an essential tool for researchers studying protein-protein interactions or exploring potential therapeutic targets.</p>

<p>Rabbit polyclonal TOM70 antibody</p>

<p>Recombinant Human CHST10 protein (His tag)</p>

<p>RABGGTA antibody was raised using the N terminal of RABGGTA corresponding to a region with amino acids ELAFTDSLITRNFSNYSSWHYRSCLLPQLHPQPDSGPQGRLPEDVLLKEL</p>

<p>LDHD antibody was raised using the middle region of LDHD corresponding to a region with amino acids LLVNPDDAEELGRVKAFAEQLGRRALALHGTCTGEHGIGMGKRQLLQEEV</p>

<p>CCNF antibody was raised in mouse using recombinant Human Cyclin F (Ccnf)</p>

<p>RANKL antibody was raised in goat using highly pure recombinant human sRANKL as the immunogen.</p>

<p>The CBL antibody is a highly specialized antibody used in the field of life sciences. It is a polyclonal antibody that targets dopamine and progesterone, among other molecules. This antibody has the unique ability to neutralize these substances, making it an essential tool for research and experimentation. The CBL antibody can be used in various applications, including immunohistochemistry, flow cytometry, and western blotting. Its high specificity and sensitivity ensure accurate and reliable results. Whether you are studying activated adipose cells or investigating the role of chemokines in disease progression, the CBL antibody is an indispensable tool in your research arsenal. Order yours today and unlock new insights in your scientific endeavors.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ATP6V0E2 antibody, catalog no. 70R-2843</p>

STEAP1 antibody was raised in mouse using recombinant human STEAP1 (1-70aa) purified from E. coli as the immunogen.

<p>Rabbit polyclonal PLCB2 antibody</p>

<p>Purified native Human PAP protein</p>

Alpha 2 macroglobulin antibody was raised in mouse using human serum alpha-2 macroglobulin as the immunogen.

<p>Rabbit polyclonal RBP4 antibody (FITC)</p>

<p>Rabbit polyclonal TRKB antibody (Tyr705)</p>

<p>CDCA5 antibody was raised using the middle region of CDCA5 corresponding to a region with amino acids ATPTSTPVPNPEAESSSKEGELDARDLEMSKKVRRSYSRLETLGSASTST</p>

<p>Purified recombinant Human OBFC1 protein (His tag)</p>

<p>SLC9A7 antibody was raised using a synthetic peptide corresponding to a region with amino acids LGWGLRVAAAASASSSGAAAEDSSAMEELATEKEAEESHRQDSVSLLTFI</p>

Neu antibody was raised in mouse using Intact SKBR-3 breast cancer cells as the immunogen.

CKMM antibody was raised in mouse using purified human CKMM as the immunogen.

<p>Trichomonas vaginalis antibody was raised in mouse using Trichomonas Vaginalis as the immunogen.</p>

<p>Purified native Porcine Haptoglobin protein</p>

<p>Rabbit polyclonal HSD11B1 antibody</p>

<p>Rabbit polyclonal RAP2B antibody</p>

<p>CASD1 antibody was raised using the N terminal of CASD1 corresponding to a region with amino acids MAALAYNLGKREINHYFSVRSAKVLALVAVLLLAACHLASRRYRGNDSCE</p>

<p>Purified Polyclonal Kanadaptin antibody</p>

<p>ALG1 antibody was raised using the N terminal of ALG1 corresponding to a region with amino acids VVLGDVGRSPRMQYHALSLAMHGFSVTLLGFCNSKPHDELLQNNRIQIVG</p>

<p>Rabbit polyclonal TLE1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Gm13178 antibody, catalog no. 70R-8604</p>

<p>Purified Rabbit polyclonal BCLXL antibody (Ser62)</p>

<p>Purified recombinant MOB1B protein (His tag)</p>

<p>The Ly6G antibody is a trifunctional monoclonal antibody that is widely used in the field of Life Sciences. It is commonly used for research purposes, specifically in the detection and analysis of various proteins and molecules. This antibody has phosphatase activity, making it a valuable tool for studying signal transduction pathways.</p>

<p>The CD86 antibody is a monoclonal antibody that is widely used in life sciences research. This antibody specifically targets the CD86 antigen, which is expressed on the surface of various immune cells. The CD86 antibody can be used for a variety of applications, including immunohistochemistry, flow cytometry, and Western blotting. It has been shown to have neutralizing activity against the CD86 antigen and can inhibit its interaction with other molecules involved in immune response regulation. Additionally, this antibody has been found to have potential therapeutic applications, particularly in the treatment of inflammatory diseases and cancer. With its high specificity and versatility, the CD86 antibody is an essential tool for researchers in the field of immunology and beyond.</p>

<p>Rabbit polyclonal GPR143 antibody</p>

<p>OLIG3 antibody was raised in rabbit using the N terminal of OLIG3 as the immunogen</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting active compounds and exhibiting bactericidal activity. Through its unique mechanism of action, this drug inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Extensive research has shown its high efficacy through patch-clamp technique analysis on human erythrocytes.</p>

<p>Mouse monoclonal TCP11L2 antibody</p>

<p>Rabbit polyclonal APIP antibody</p>

<p>Rabbit polyclonal RINT1 antibody</p>

<p>The TIM3 antibody is a monoclonal antibody that targets the TIM-3 protein, which plays a crucial role in regulating immune responses. This antibody specifically recognizes and binds to the glycosylation site on the TIM-3 protein, inhibiting its function. By blocking the interaction between TIM-3 and its ligands, this antibody helps modulate immune responses and can be used for various applications in life sciences research.</p>

<p>The LIF antibody is a monoclonal antibody that targets the inhibitory factor known as leukemia inhibitory factor (LIF). This antibody has been extensively studied in the field of Life Sciences and has various applications. It can be used for detecting and quantifying LIF levels in biological samples, such as serum or tissue extracts, using techniques like ELISA or Western blotting. The LIF antibody can also be used for immunohistochemistry to visualize LIF expression in cells or tissues.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of UBE2F antibody, catalog no. 70R-9184</p>

<p>Ccl11 antibody was raised in rabbit using the C terminal of Ccl11 as the immunogen</p>

<p>Human Albumin antibody was raised against Human Albumin.</p>

<p>Rabbit polyclonal rPSB antibody (FITC)</p>

<p>The HSF1 antibody is a highly specific monoclonal antibody that targets human serum albumin (HSA). It is commonly used in immunoassays and molecular docking studies to detect and analyze the presence of HSA in various samples. This antibody forms a stable complex with HSA, allowing for accurate quantification and analysis.</p>

<p>DTL antibody was raised using a synthetic peptide corresponding to a region with amino acids VNQISGAHNTSDKQTPSKPKKKQNSKGLAPSVDFQQSVTVVLFQDENTLV</p>

<p>The FGF21 antibody is a monoclonal antibody that specifically targets and inhibits the growth factor FGF21. This antibody has been shown to effectively block the activation of FGF21, preventing its binding to its receptors and subsequent downstream signaling. By blocking FGF21 activity, this antibody can potentially inhibit the growth and proliferation of cells that are dependent on FGF21 signaling.</p>

<p>PWWP2A antibody was raised using the C terminal of PWWP2A corresponding to a region with amino acids PQSRCTSTRSAGLNKWQLLHQTVTSPAAPLQCLTDHCGFRLGALKLTVKR</p>