Prodotti biochimici e reagenti

<p>Sodium pyrophosphate decanhydrate is a methyltransferase inhibitor that blocks the enzyme form of the DNA methyltransferase, which is responsible for maintaining DNA methylation patterns. It has been shown to inhibit the enzymatic activity of this enzyme in a model system. Sodium pyrophosphate decanhydrate inhibits the growth of bacteria by binding to water molecules and preventing them from binding to other molecules, causing dehydration. This drug also has potential as a natriuretic peptide levels inhibitor, with electrochemical impedance spectroscopy studies showing that it may have a high affinity for sodium ions. Studies have also shown that sodium pyrophosphate decanhydrate has no toxicity in mice.</p>

<p>Please enquire for more information about 1,9-Dichloro-3,7-diazanonane dihydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>ELISA kit for detection of MMP1 in the research laboratory</p>

<p>p-Perfluoroterphenyl is a potent inhibitor of kinases, which are enzymes that play a crucial role in the regulation of cell growth and division. This compound has been extensively studied in Chinese medicinal research for its anticancer properties. It has been shown to inhibit the growth of tumor cells and induce apoptosis, or programmed cell death, in cancer cells. Additionally, p-Perfluoroterphenyl has been found to be an effective inhibitor of protein kinases, which regulate many important cellular processes. This analog has also been detected in human urine samples, indicating its potential as a diagnostic tool for cancer detection and treatment. Overall, p-Perfluoroterphenyl is a promising new compound with potential applications in cancer therapy and diagnosis.</p>

<p>Hamster (CHO) Legumain ELISA Kit<br> <br>Legumain is a host cell protein (HCP) generated by CHO cells during production of biotherapeutics. This process-related impurity accumulates in the extracellular space as it is released from dead CHO cells and secreted from viable cells during cell culture. Legumain, a lysosomal protease, cleaves the asparaginyl and aspartyl bonds of therapeutic monoclonal antibodies, thus compromising their integrity, stability, and efficacy.</p>

<p>ELISA kit for the detection of CA 199 in the research laboratory</p>

<p>Please enquire for more information about CHO LPLA2 ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Tosedostat-d5 is an analog of Tosedostat, an anticancer drug that inhibits the activity of a variety of kinases involved in cancer cell growth and survival. This compound has been shown to induce apoptosis in human cancer cells and has demonstrated promising results in preclinical studies. Tosedostat-d5 is labeled with five deuterium atoms, which makes it useful as a tracer for pharmacokinetic and metabolic studies. It is also used as a tool for investigating the metabolism of other drugs, such as rifampicin and astaxanthin, in Chinese hamster ovary cells. Inhibitors of tosedostat-d5 have been developed for use in cancer therapy, making this compound an important tool for research into new anticancer treatments.</p>

<p>For the quantitative determination of canine/dog albumin in biological samples.</p>

<p>ELISA Kit for detection of AVP in the research laboratory</p>

<p>Please enquire for more information about Dog IgG ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Human Albumin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Cat IgE ELISA Kit</p>

<p>Hamster (CHO) Nidogen-1 ELISA Kit<br> <br>Nidogen-1 is a host cell protein (HCP) generated by CHO cells during production of biotherapeutics. This process-related impurity accumulates in the extracellular space as it is released from dead CHO cells and secreted from viable cells during cell culture. Nidogen-1 interacts with the Fc region of therapeutic monoclonal antibodies and is particularly difficult contaminant to remove even after polishing steps.</p>

<p>Highly sensitive Mouse Albumin ELISA kits are for the measurement of albumin in your samples. The kits are complete with ready to use reagents necessary to perform the assays.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of P2RX2 antibody, catalog no. 70R-5171</p>

<p>ELISA kit for the detection of Toxoplasma gondii IgG in the research laboratory</p>

<p>Please enquire for more information about Rat Transferrin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>ELISA kit for the detection of Cardiolipin screen IgG/IgM/IgA1 in the research laboratory</p>

<p>Please enquire for more information about Monkey Albumin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>ELISA kit for detection of BAFF in the research laboratory</p>

<p>ELISA Kit for detection of CEA in the research laboratory</p>

<p>LCP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids FIKIFHGLKSTDVAKTFRKAINKKEGICAIGGTSEQSSVGTQHSYSEEEK</p>

<p>ELISA kit for the detection of TRAIL in the research laboratory</p>

<p>Goat polyclonal Human Ceruloplasmin antibody</p>

<p>Human Novel Coronavirus Nucleoprotein (SARS-CoV-2 N) IgG Ab ELISA Kit</p>

<p>ELISA kit for the detection of Gliadin IgA in the research laboratory</p>

<p>Bestatin-amido-Me is a high purity, water soluble, and stable small molecule that can be used as a pharmacological research tool. It has been shown to inhibit protein interactions with receptors in the human body. Bestatin-amido-Me is also an inhibitor of ion channels and ligands for antibodies. This substance has been shown to inhibit receptor activation by peptides or other ligands at concentrations of 1mM or less. The chemical name for this substance is bestatin amide methylamide hydrochloride and its CAS number is 339186-54-8.</p>

<p>Please enquire for more information about Mouse Alpha 1-Antitrypsin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>C-reactive protein (CRP) is a substance produced by the liver in response to inflammation. It is a marker of inflammation in the body and is often used in medical settings to assess the presence and severity of inflammation. CRP levels can rise in response to various conditions, including infections, injuries, and chronic inflammatory diseases.<br>High levels of CRP in the blood can indicate the presence of inflammation, but it doesn't pinpoint the exact cause. It is commonly used in combination with other clinical and laboratory findings to help diagnose and monitor conditions such as infections, autoimmune diseases, and cardiovascular diseases. Elevated CRP levels may also be associated with conditions like rheumatoid arthritis, inflammatory bowel disease, and certain cancers.</p>

<p>ELISA Kit for detection of Thyroxine in the research laboratory</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of STAT5B antibody, catalog no. 20R-1134</p>

<p>ELISA Kit for detection of Thyroxine in the research laboratory</p>

<p>Myeloperoxidase antibody was raised in mouse using human myeloperoxidase as the immunogen.</p>

<p>This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.</p>

<p>ELISA kit for detection of Fibronectin in the research laboratory</p>

<p>The SMAD6 antibody is a monoclonal antibody that has the ability to neutralize specific virus surface antigens. This antibody specifically targets and binds to the superoxide glucagon receptor, preventing its activation and subsequent signaling cascade. As a result, the antibody inhibits the nuclear translocation of specific antibodies involved in viral replication and immune evasion.</p>

<p>Tetanus toxin antibody is a monoclonal antibody that specifically targets and neutralizes the tetanus toxin. This antibody is derived from alpha-fetoprotein and has been extensively studied in the field of Life Sciences. It binds to the tetanus toxin, preventing it from binding to its target receptors and exerting its toxic effects. Additionally, this antibody has been shown to inhibit the activity of TGF-beta, a growth factor involved in various cellular processes. The binding proteins present in this antibody can effectively block the interaction between TGF-beta and its receptors, leading to the inhibition of downstream signaling pathways. Furthermore, studies have demonstrated that this monoclonal antibody can also bind to autoantibodies and other proteins involved in disease progression. With its high specificity and efficacy, tetanus toxin antibody holds great potential for therapeutic applications in various medical conditions.</p>

<p>ELISA kit for the detection of Centromere B in the research laboratory</p>

<p>ELISA kit for the detection of PGE2 in the research laboratory</p>

<p>ELISA kit for detection of BDNF in the research laboratory</p>

<p>ELISA kit for the detection of Alpha Fodrin in the research laboratory</p>

<p>Hamster (CHO) Matrix metalloproteinase-19 (MMP-19) ELISA Kit</p>

<p>ELISA kit for the detection of CA 15-3 in the research laboratory</p>

<p>C-reactive protein (CRP) is a substance produced by the liver in response to inflammation. It is a marker of inflammation in the body and is often used in medical settings to assess the presence and severity of inflammation. CRP levels can rise in response to various conditions, including infections, injuries, and chronic inflammatory diseases.<br>High levels of CRP in the blood can indicate the presence of inflammation, but it doesn't pinpoint the exact cause. It is commonly used in combination with other clinical and laboratory findings to help diagnose and monitor conditions such as infections, autoimmune diseases, and cardiovascular diseases. Elevated CRP levels may also be associated with conditions like rheumatoid arthritis, inflammatory bowel disease, and certain cancers.</p>

<p>Please enquire for more information about Mouse Prealbumin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>ELISA kit for the detection of Thyroglobulin in the research laboratory</p>

<p>Mouse Plasminogen ELISA Kit</p>

<p>ELISA kit for detection of Testosterone in the research laboratory</p>

<p>C-reactive protein (CRP) is a substance produced by the liver in response to inflammation. It is a marker of inflammation in the body and is often used in medical settings to assess the presence and severity of inflammation. CRP levels can rise in response to various conditions, including infections, injuries, and chronic inflammatory diseases.<br>High levels of CRP in the blood can indicate the presence of inflammation, but it doesn't pinpoint the exact cause. It is commonly used in combination with other clinical and laboratory findings to help diagnose and monitor conditions such as infections, autoimmune diseases, and cardiovascular diseases. Elevated CRP levels may also be associated with conditions like rheumatoid arthritis, inflammatory bowel disease, and certain cancers.<br>;</p>

<p>Tetanus toxin antibody is a monoclonal antibody that acts as an inhibitor of the tetanus toxin. It belongs to the class of antibodies known as neutralizing antibodies, which are active agents in the field of life sciences. This monoclonal antibody specifically targets and neutralizes the effects of tetanus toxin by binding to it and preventing it from causing harm. Additionally, this antibody has been shown to have potential therapeutic applications in other areas, such as inhibiting the activity of epidermal growth factor (EGF) and atypical hemolytic autoantibodies. With its versatility and efficacy, this monoclonal antibody offers promising possibilities for medical research and treatment options.</p>

<p>Horse IgG ELISA kit is intended for the quantitative determination of total horse IgG in biological samples.</p>

<p>ELISA Kit for detection of Mullerian hormone in the research laboratory</p>

<p>Mouse Transferrin ELISA Kit</p>

<p>SEK1 antibody is a highly specialized product used in the field of Life Sciences. It is available as both polyclonal and monoclonal antibodies, offering researchers flexibility in their experiments. This antibody specifically targets glycopeptides, which are high polymers with glycosylation. It is commonly used for various applications, including the study of hormone peptides and intraocular processes.</p>

<p>Please enquire for more information about Rat Ferritin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>HEMISODIUM® HEPES is a buffered solution of sodium salt of HEPES, a buffer with the pH between 7.4 and 8.0, prepared from an aqueous solution of disodium hydrogen phosphate and sodium hydroxide. This buffer is used in biochemical research for its ability to inhibit voltage-dependent calcium channels and induce cell lysis. It also has antimicrobial properties that can be used as treatment for bacterial infections. HEMISODIUM® HEPES has been shown to be effective against some strains of methicillin-resistant Staphylococcus aureus (MRSA) and Mycobacterium tuberculosis in vitro.</p>

<p>Tiotropium bromide is a long-acting bronchodilator that is used to relieve the symptoms of asthma and chronic obstructive pulmonary disease. It is a crystalline drug with an extended duration of action. Tiotropium bromide acts by binding to the beta2-adrenergic receptor, which prevents activation of these receptors and inhibits the release of inflammatory mediators. This drug has been shown to be effective for up to 12 months in adults with asthma who are not responsive to standard therapy. Tiotropium bromide does not interact significantly with other drugs, but should be used cautiously in patients with liver impairment or congestive heart failure due to its potential for adverse effects on these organs.</p>

<p>ELISA Kit for detection of Prolactin in the research laboratory</p>

<p>The Cat IgG ELISA kit is intended for the quantitative determination of total cat IgG in biological samples.</p>

<p>Bovine Lactoferrin ELISA Kit</p>

<p>Thymus factor X is a protein that has been shown to inhibit proliferation of cancer cells in animal models. It has also been shown to have an inhibitory effect on the growth of mesenteric cancer cells and on human hepatitis B virus. Thymus factor X is a basic protein that stimulates apoptosis, or programmed cell death, by binding to monoclonal antibodies and triggering cellular events that lead to the breakdown of DNA. It also inhibits production of inflammatory cytokines in response to skin tests. Thymus factor X is active against infectious diseases such as tuberculosis, bacterial pneumonia, and chickenpox. The drug is currently being studied for use in treating primary sclerosing cholangitis, which is a chronic inflammatory disease of the bile ducts.<br>Thymus Factor X may be used therapeutically for autoimmune diseases such as rheumatoid arthritis and multiple sclerosis, but further research needs to be done before it can be approved for any therapeutic purposes.</p>

<p>Please enquire for more information about Rat CRP ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Rabbit IgA ELISA Kit</p>

<p>Please enquire for more information about Human Apolipoprotein A1 ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Rat IgE ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Rat IgG ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>ELISA kit for detection of CXCL10 in the research laboratory</p>

<p>GPR37L1 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Rat Fatty Acid Binding Protein ELISA Kit</p>

<p>Please enquire for more information about Mouse IgG2A ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Dog KIM-1 ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Complement C3 is a protein that plays a crucial role in the immune system as part of the complement system. The complement system is a complex network of proteins that work together to enhance the immune response against pathogens such as bacteria and viruses. Complement C3 is one of the central components of this system.<br>When the complement system is activated, C3 is cleaved into two fragments: C3a and C3b. C3b plays a key role in opsonization, a process in which pathogens are marked for destruction by phagocytic cells, such as macrophages. Additionally, C3b participates in the formation of the membrane attack complex (MAC), which can directly lyse and kill certain pathogens.<br>The complement system is an essential part of the immune defense mechanism, contributing to the body's ability to recognize and eliminate foreign invaders. Dysregulation of the complement system has been associated with various autoimmune diseases and inflammatory conditions.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Vamp1 antibody, catalog no. 70R-9794</p>

<p>C-reactive protein (CRP) is a substance produced by the liver in response to inflammation. It is a marker of inflammation in the body and is often used in medical settings to assess the presence and severity of inflammation. CRP levels can rise in response to various conditions, including infections, injuries, and chronic inflammatory diseases.<br>High levels of CRP in the blood can indicate the presence of inflammation, but it doesn't pinpoint the exact cause. It is commonly used in combination with other clinical and laboratory findings to help diagnose and monitor conditions such as infections, autoimmune diseases, and cardiovascular diseases. Elevated CRP levels may also be associated with conditions like rheumatoid arthritis, inflammatory bowel disease, and certain cancers.</p>

<p>AMBMP Hydrochloride is a synthetic compound, specifically designed for research purposes in the field of neuroscience. This compound is derived from a series of carefully crafted chemical reactions, typically originating from a laboratory setting specializing in organic synthesis. Its primary mode of action is as a selective ligand targeting specific receptors within the central nervous system, allowing researchers to investigate receptor function and signaling pathways with precision.</p>

<p>Human KIM-1 ELISA Kit</p>

<p>ELISA kit for the detection of Chlamydia Pneumoniae IgA in the research laboratory</p>

<p>ELISA kit for the detection of Human Bax in the research laboratory</p>

<p>ELISA kit for the detection of Parvovirus IgG in the research laboratory</p>

<p>Mouse monoclonal IgG1 kappa Isotype Control Fc fusion protein</p>

<p>This Human Transferrin ELISA Kit reacts similarly with apo-transferrin and holo-transferrin.</p>

<p>ELISA Kit for detection of Leptin in the research laboratory</p>

<p>Recombinant Human POLR2K protein</p>

<p>Testosterone 3 antibody was raised in rabbit using testosterone-3 BSA as the immunogen.</p>

<p>ELISA kit for the detection of Annexin V in the research laboratory</p>

<p>Please enquire for more information about Human Prealbumin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Human KLK2(Kallikrein-2) ELISA Kit</p>

<p>Purified recombinant Human DECR1 protein</p>

<p>ELISA Kit for detection of IgM in the research laboratory</p>

<p>PDGFB antibody was raised using the N terminal of PDGFB corresponding to a region with amino acids NRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGD</p>

<p>Rat IgM ELISA Kit</p>

<p>Custom research peptide; min purity 95%.</p>

<p>ELISA Kit for detection of Vasopressin in the research laboratory</p>

<p>Please enquire for more information about Rat Hemoglobin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>The Sheep IgG ELISA kit is intended for the quantitative determination of total sheep IgG in biological samples.</p>

<p>Mouse Fetuin/AHSG ELISA Kit.</p>

<p>Human Fetuin/AHSG ELISA Kit</p>

<p>Rapalink-1 is a gene therapy drug that has been shown to be effective against resistant mutants of malignant brain tumors. Rapalink-1 is a protein that has been engineered to bind to mesenchymal markers and inhibit the progression of cancer cells. This protein also has the ability to induce autophagy, which can lead to axonal growth and help with ischemia–reperfusion injury in pediatric patients. Rapalink-1 inhibits tumor growth by triggering autophagy, which can lead to axonal growth and help with ischemia–reperfusion injury in pediatric patients. Rapalink-1 is an autophagy inducer that binds to mesenchymal markers on cancer cells and inhibits the progression of cancer cells. It also has the ability to induce autophagy, which can lead to axonal growth and help with ischemia–reperfusion injury in pediatric patients.</p>

<p>GNRHR antibody was raised in Rabbit using Human GNRHR as the immunogen</p>

<p>The Tau antibody is a mouse monoclonal antibody that is widely used in Life Sciences research. It specifically binds to the peptide sequence of Tau protein, which plays a crucial role in neurodegenerative diseases such as Alzheimer's disease. This antibody has been extensively studied and validated for its high affinity and specificity towards Tau protein.</p>

<p>ELISA kit for the detection of Calcitonin in the research laboratory</p>

<p>ELISA kit for the detection of MicroAlbumin in the research laboratory</p>

<p>ELISA kit for the detection of ANA in the research laboratory</p>

<p>Mouse Hemopexin ELISA Kit</p>

<p>Cortisol ELISA Kit for the determination of cortisol in human serum and plasma</p>

<p>ELISA kit for the detection of GBM in the research laboratory</p>

<p>ELISA kit for the detection of Histamine in foodstuffs in the research laboratory</p>

<p>CEA antibody was raised in mouse using human colon adrenocarcinoma as the immunogen.</p>

<p>MOG(35-55) human corresponds to amino acids 35 to 55 of the human myelin oligodendrocyte glycoprotein (MOG). It can be used in multiple sclerosis research to induce experimental autoimmune encephalomyelitis (EAE) in mouse and rat models.</p>

<p>ELISA kit for detection of IL18 in the research laboratory</p>

<p>PTH antibody was raised in goat using human PTH as the immunogen.</p>

<p>ELISA kit for the detection of Prothrombin IgG/IgM in the research laboratory</p>

<p>ELISA kit for the detection of ssDNA in the research laboratory</p>

<p>ELISA kit for the detection of Pregnenolone  in the research laboratory</p>

<p>ELISA kit for the detection of IL1 beta in the research laboratory</p>

<p>ELISA kit for the detection of Dopamine in the research laboratory</p>

<p>TAPI-2 is an inhibitor of ADAM-17 (also called TACE) and matrix metalloproteinases (MMPs). It acts as a broad-spectrum inhibitor of these enzymes. TAPI-2 prevents the shedding of tumor necrosis factor-alpha (TNF-α) from cell membranes and can sensitize cancer stem cells to the effects of chemotherapy such as 5-fluorouracil (5-FU) in vitro. It also blocks the phorbol ester-induced shedding of other cell surface proteins like TGF-α and β-amyloid precursor protein.</p>

<p>Influenza A Antigen Capture ELISA for use in the research laboratory</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SPOPL antibody, catalog no. 70R-8870</p>

<p>ELISA kit for the detection of Sm1 in the research laboratory</p>

<p>ELISA Kit for detection of Calcitonin in the research laboratory</p>

<p>Recombinant SARS-CoV-2 Spike S1 Receptor Binding Domain (RBD; GenBank QHD43416.1, a.a.318-541) with a 6xHIS tag was expressed in HEK293 cells and purified by nickel affinity chromatography. Under SDS-PAGE reducing conditions, the protein is detected at an estimated molecular weight of ~35 kDa. Optimal working dilutions should be determined experimentally by the investigator.</p>

<p>Cat CRP ELISA Kit - For the quantitative determination of c-reactive protein (CRP) in cat/feline samples.</p>

<p>Please enquire for more information about Human Myeloperoxidase (MPO) ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>ELISA kit for detection of Histamine in the research laboratory</p>

<p>CRP antibody was raised in mouse using human CRP derived from pleural/ascetic fluid or plasma as the immunogen.</p>

<p>Quantify pig albumin in your samples.</p>

<p>Hamster (CHO) Glutathione S Transferase Pi (GSTp) ELISA Kit<br>Glutathione S-transferase Pi (GSTp) is a metabolic enzyme that facilitates metabolite detoxification and antioxidation. GSTp reduces efficacy of chemotherapy drugs and inhibits tumor-cell apoptosis.</p>

<p>ELISA Kit for detection of IgG in the research laboratory</p>

<p>SARS-CoV-2 Spike RBD Antibody Pair 1</p>

<p>ELISA Kit for detection of Prostaglandin E2 in the research laboratory</p>

<p>Cat Haptoglobin ELISA Kit</p>

<p>ELISA Kit for detection of MMP1 in the research laboratory</p>

<p>ELISA kit for the detection of Human Leptin in the research laboratory</p>

<p>Interleukin 6 (IL-6) is primarily produced at sites of acute and chronic inflammation, where it is secreted into the serum and induces a transcriptional inflammatory response through interleukin 6 receptor, alpha.</p>

<p>CD152 antibody (PE) was raised in hamster using murine CD152/CTLA-4 as the immunogen.</p>

<p>Calibrator for Chicken ELISA Kit</p>

<p>Canine/Dog Thymidine Kinase (TK1) ELISA Kit</p>

<p>ELISA Kit for detection of IgA in the research laboratory</p>

<p>ELISA kit for the detection of ANCA combi in the research laboratory</p>

<p>Neutrophil Gelatinase Associated Lipocalin (NGAL) is a lipocalin protein that is involved in many physiological and pathophysiological processes. NGAL binds to bacterial products, such as lipopolysaccharide, and can be used as a biomarker for inflammation or infection. NGAL has been shown to be elevated in the urine of patients with urinary tract infections. Additionally, NGAL has been shown to be associated with neurological diseases, such as Alzheimer's disease and Parkinson's disease. The recombinant human form of this protein can be used for research purposes or for the development of diagnostic tools. Neutrophil Gelatinase Associated Lipocalin (NGAL) is a lipocalin protein that is involved in many physiological and pathophysiological processes. It binds to bacterial products, such as lipopolysaccharide, and can be used as a biomarker for inflammation or infection. NGAL has been shown to be elevated in the urine of patients</p>

<p>NECAP1 antibody was raised in Rabbit using Human NECAP1 as the immunogen</p>

<p>ELISA Kit for detection of Estradiol antibody in the research laboratory</p>

<p>ELISA kit for the detection of OPG in the research laboratory</p>

<p>The Pig IgG ELISA kit is intended for the quantitative determination of total pig IgG in biological samples.</p>

<p>ELISA kit for detection of Human IL10 in the research laboratory</p>

<p>ELISA Kit for detection of PGD2 in the research laboratory</p>

<p>PEX5 antibody was raised using the middle region of PEX5 corresponding to a region with amino acids LNMQRKSRGPRGEGGAMSENIWSTLRLALSMLGQSDAYGAADARDLSTLL</p>

<p>ELISA kit for the detection of Cystatin C in the research laboratory</p>

<p>Influenza A Calibration Kit for the production of Influenza A Nucleoprotein calibration curve</p>

<p>TTC27 antibody was raised in rabbit using the N terminal of TTC27 as the immunogen</p>

<p>ELISA kit for the detection of Mac2BP in the research laboratory</p>

<p>Rabbit Plasminogen ELISA Kit</p>

<p>(4bS,8aS,9S,10S)-10-(Acetyloxy)-3,9-bis(benzoyloxy)-4b,5,6,7,8,8a,9,10-octahydro-4b,8,8-trimethyl-2-(1-methylethyl)-1,4-phenanthrene dione is a potent chemokine molecule that is an agonist of the CXCR2 receptor. It has been shown to inhibit cancer stem cells and chemoattractant production in colon carcinoma cells. This compound selectively targets the translation of lamiaceae mRNA and induces apoptosis in colon carcinoma cells.</p>

<p>ELISA kit for the detection of CRP in the research laboratory</p>

<p>ELISA kit for the detection of Dengue Virus IgM in the research laboratory</p>

<p>SLV-2436 is a highly specialized laboratory reagent, which is synthetically derived through an advanced chemical process with rigorous quality control. Its mode of action involves precise interactions at a molecular level, facilitating targeted reactions and transformations essential for a variety of analytical and research applications.</p>

<p>ELISA kit for the detection of Parietal Cell in the research laboratory</p>

<p>Please enquire for more information about Human Ferritin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Sheep Haptoglobin ELISA Kit;</p>

<p>ELISA Kit for detection of Prolactin in the research laboratory</p>

<p>(R)-Funapide is a ligand that binds to the activator site of the nicotinic acetylcholine receptor (nAChR) and has been shown to activate this receptor. It is used as a research tool in cell biology, ion channels, peptides, and antibodies. (R)-Funapide has also been shown to inhibit protein interactions with a number of different receptors.</p>

<p>ELISA kit for detection of BDNF in the research laboratory</p>

<p>Mouse monoclonal IgG1 Kappa Isotype Control antibody (Biotin)</p>

<p>ELISA kit for the detection of Human HGF in the research laboratory</p>

<p>Fibrinogen is a glycoprotein in the blood that plays a crucial role in blood clotting and wound healing. It is produced by the liver and circulates in the blood plasma. When there is an injury that causes bleeding, fibrinogen is converted into fibrin through a series of enzymatic reactions, forming a mesh-like structure that helps to stop bleeding by forming a blood clot. This process is part of the body's natural response to injuries and is essential for maintaining hemostasis, the prevention of excessive bleeding.</p>

<p>CD30 antibody (FITC) was raised in hamster using recombinant murine CD30 extracellular domain-mouse IgG1 fusion protein as the immunogen.</p>

<p>ELISA kit for detection of MMP2 in the research laboratory</p>

<p>Monkey Cystatin C ELISA Kit</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>CJC-1295 is a synthetic peptide, which is an analogue of growth hormone-releasing hormone (GHRH). It is synthesized through recombinant DNA technology, which allows for precise control over its sequence and length. This particular peptide is designed to bind to GHRH receptors in the pituitary gland. By activating these receptors, CJC-1295 stimulates the release of growth hormone (GH) into the bloodstream.The primary function of CJC-1295 is to influence the endocrine system, particularly enhancing the release of endogenous growth hormone. It achieves this by increasing the amplitude and frequency of GH pulses without affecting the natural negative feedback mechanisms that regulate GH production. This mode of action distinguishes CJC-1295 from other growth hormone therapies, as it promotes a more physiological pattern of hormone secretion.CJC-1295 is used in various scientific contexts, primarily in research focusing on growth hormone deficiencies, muscle wasting conditions, and certain metabolic disorders. Its ability to increase GH release also makes it a subject of interest in studies related to aging, tissue repair, and regeneration. The longer half-life of CJC-1295 compared to natural GHRH peptides further enhances its applications in research, allowing for more sustained and controlled experimentation.</p>

<p>05:0 PC is a peptide binding sequence that has been shown to inhibit the replication of viral sequences. 05:0 PC binds to the amino acid sequence in protein, which is a model system for peptide binding. The endoplasmic reticulum, or ER, is the site of synthesis for proteins and its low efficiency may be due to the spontaneous nature of the protein synthesis process. The ER can also be seen as an inhibitor molecule that prevents the virus from replicating. 05:0 PC has been shown to inhibit papillomavirus and HIV-1 replication in vitro. This peptide has also been shown to block interactions between viruses and cells that allow viral replication.</p>

<p>Myelin oligodendrocyte glycoprotein (MOG) is a myelin protein found in the central nervous system. MOG is a ligand for CD200, which is an inhibitory receptor expressed by astrocytes. It has been shown that MOG can induce the proliferation and differentiation of primary cultures of rat astrocytes in vitro. MOG induces the production of reactive oxygen species in mitochondria and increases the expression of acid-binding protein, which are both important factors in the demyelination process. MOG has also been implicated as a potential factor in the development of multiple sclerosis. Further research into this protein may lead to new treatments or cures for disorders such as encephalomyelitis, nervous system diseases, or even cancer.</p>

<p>Mesotocin is a peptide hormone that has a role in the regulation of water permeability and estradiol benzoate. It also regulates the physiological functions of the brain and has been shown to be involved in congestive heart failure, as it causes an increase in blood pressure. Mesotocin is found at high levels in human serum, but its activity is dependent on the presence of other hormones such as estradiol benzoate. The biological properties of mesotocin are largely unknown, although it is known to have receptor activity. The effects of this hormone on the kidney have been studied using mesotocin trifluroacetate (MTFA) and monoclonal antibody (mAb). MTFA causes an increase in glomerular filtration rate (GFR), which may be due to its ability to inhibit angiotensin II-induced vasoconstriction and decrease vascular resistance.</p>