Prodotti biochimici e reagenti

<p>Ceftiofur Conjugate for use in immunoassays</p>

<p>GOSR2 antibody was raised in Rabbit using Human GOSR2 as the immunogen</p>

<p>Rat monoclonal B7RP1 antibody (PE)</p>

<p>Cytokeratin 19 antibody is a low-molecular-weight monoclonal antibody that specifically binds to cytokeratin 19, a protein found in epithelial cells. This antibody has been used in various applications in the field of life sciences, including research and diagnostics. It can be used to detect and quantify cytokeratin 19 expression in tissues and cells, making it a valuable tool for studying epithelial cell biology. The dextran sulfate conjugated to the antibody enhances its stability and allows for efficient binding to target molecules. Whether you're conducting experiments or developing new diagnostic assays, this cytokeratin 19 antibody is an essential component for your research toolkit. Trust its high specificity and sensitivity to deliver accurate and reliable results.</p>

<p>Rabbit polyclonal TXLNA antibody</p>

<p>ELISA buffer for optimal coating and binding of antibodies and antigens</p>

<p>CD4 antibody (PE) was raised in mouse using human CD4 as the immunoge.</p>

<p>Rabbit polyclonal Kinase E9 antibody</p>

<p>Purified recombinant DOK4 protein (His tag)</p>

<p>GYG1 antibody was raised in Rabbit using Human GYG1 as the immunogen</p>

<p>LPIN2 antibody was raised in Rabbit using Human LPIN2 as the immunogen</p>

<p>The CD13 antibody is a powerful tool used in Life Sciences research. It is a monoclonal antibody that specifically targets CD13, also known as Aminopeptidase N. This protein plays a crucial role in various physiological processes, including cell adhesion, migration, and signal transduction.</p>

<p>LMOD3 antibody was raised in Rabbit using Human LMOD3 as the immunogen</p>

<p>PIWIL4 antibody was raised using a synthetic peptide corresponding to a region with amino acids LSNNEASSSNGFLGTSRISTNDKYGISSGDAGSTFMERGVKNKQDFMDLS</p>

<p>The TACC3 antibody is a protein that acts as a monoclonal antibody. It specifically targets TNF-related apoptosis-inducing ligand (TRAIL), which plays a crucial role in cell death regulation. The TACC3 antibody has been shown to inhibit the activity of TRAIL, preventing it from triggering apoptosis in cells. This makes it an effective tool for research and development in the field of life sciences.</p>

<p>The IVD antibody is a powerful tool in the field of Life Sciences. It is a glycopeptide that specifically targets alpha-fetoprotein, chemokines, and globulins. This monoclonal antibody is designed to recognize and bind to specific antigens, allowing for precise detection and analysis. With its glycosylation properties, the IVD antibody can effectively neutralize and inhibit factors that may be harmful to the body. Additionally, it has been shown to have neuroprotective effects and can enhance the activity of interferon-gamma (IFN-gamma). Its ability to interact with glycans makes it a versatile tool in various research applications. Trust the IVD antibody to provide accurate and reliable results for your experiments and studies.</p>

<p>The GPI antibody is a biomolecule that belongs to the class of antibodies. It has been shown to have neutralizing effects on influenza hemagglutinin and is widely used in the field of Life Sciences. This monoclonal antibody can be used in various applications, including as a diagnostic tool or therapeutic agent. It has been extensively studied and characterized for its ability to bind specifically to its target antigen. The GPI antibody has been used in research studies involving DNA vaccines, neonatal serum, and human serum samples. Additionally, it has been utilized in the detection and measurement of autoantibodies, such as antiphospholipid antibodies, making it an invaluable tool for researchers in this field. With its high specificity and affinity, this monoclonal antibody is an essential component in various scientific experiments and assays.</p>

<p>Rabbit polyclonal Prx III antibody</p>

<p>MINK1 antibody was raised in Rabbit using Human MINK1 as the immunogen</p>

<p>Rabbit polyclonal TASP1 antibody</p>

<p>Rabbit polyclonal RANBP6 antibody</p>

<p>ZBTB26 antibody was raised in rabbit using the C terminal of ZBTB26 as the immunogen</p>

<p>Inhibitor of ribosomal protein kinase p70S6K</p>

<p>Ece2 antibody was raised in rabbit using the middle region of Ece2 as the immunogen</p>

<p>Purified Polyclonal CNGB1 antibody</p>

<p>The iNOS antibody is a highly specialized polyclonal antibody that targets the inducible nitric oxide synthase (iNOS). It is commonly used in life sciences research to study the role of iNOS in various biological processes. This antibody specifically binds to iNOS and can be used for applications such as immunohistochemistry, western blotting, and flow cytometry.</p>

<p>Rabbit polyclonal STK33 antibody</p>

<p>Hepatitis C virus antibody was raised in mouse using hepatitis C core antigen as the immunogen.</p>

<p>This antibody reacts with heavy chains on Donkey IgG and light chains on all Donkey immunoglobulins.</p>

<p>Mouse monoclonal SGCD antibody</p>

<p>MRPL45 antibody was raised in Rabbit using Human MRPL45 as the immunogen</p>

<p>SLCO5A1 antibody was raised in rabbit using the middle region of SLCO5A1 as the immunogen</p>

<p>Rabbit polyclonal SPIN2B antibody</p>

<p>GALNT6 antibody was raised using a synthetic peptide corresponding to a region with amino acids EIIPCSVVGHVFRTKSPHTFPKGTSVIARNQVRLAEVWMDSYKKIFYRRN</p>

<p>Mouse monoclonal PDSS2 antibody</p>

<p>KIF12 antibody was raised using the N terminal of KIF12 corresponding to a region with amino acids SLGSPRPLPVRWNKTRGFYVEQLRVVEFGSLEALMELLQTGLSRRRNSAH</p>

<p>KIAA1468 antibody was raised in Rabbit using Human KIAA1468 as the immunogen</p>

<p>Rabbit polyclonal STMN1 antibody (Ser62)</p>

<p>MBP antibody was raised using the middle region of MBP corresponding to a region with amino acids FKDRPSESDELQTIQEDSAATSESLDVMASQKRPSQRHGSKYLATASTMD</p>

<p>Purified Polyclonal MGST2 antibody</p>

<p>The PPM1G antibody is a highly potent inhibitor that belongs to the class of antibodies used in Life Sciences. It exhibits an inhibitory effect on phosphatase activity, making it an essential tool for research and industrial applications. This monoclonal antibody specifically targets PPM1G, a phosphatase enzyme involved in various cellular processes. The PPM1G antibody can be used for immobilization purposes or as part of molecular modeling studies. Its specificity and high affinity make it a valuable asset in the field of antibody-based research and development.</p>

<p>Spi2A Monoclonal Antibody</p>

<p>Rabbit polyclonal cJun antibody</p>

<p>Rabbit polyclonal BAD antibody (Ser91/128)</p>

<p>Mouse monoclonal SHPK antibody</p>

<p>Rabbit polyclonal STAT6 antibody (Thr645)</p>

<p>Rabbit polyclonal MYST2 antibody</p>

<p>Rabbit polyclonal Chl78 antibody</p>

<p>Mouse monoclonal CD28 antibody (FITC); target rat</p>

<p>Folic acid-OVA conjugate</p>