Prodotti biochimici e reagenti

<p>Mouse monoclonal NT5DC1 antibody</p>

<p>CD144 antibody is a monoclonal antibody that specifically targets CD144, also known as vascular endothelial cadherin (VE-cadherin). It plays a crucial role in maintaining the integrity and stability of endothelial cell-cell junctions. CD144 antibody can be used in various life science research applications, including the study of interleukin-6 signaling, influenza hemagglutinin binding assays, and the detection of reactive oxygen species.</p>

<p>Purified Polyclonal Alpha actin 1 antibody</p>

<p>The REDD1 antibody is a highly specialized product used in Life Sciences research. It is an immunogenic composition designed to target and detect the presence of REDD1 protein in various biological samples. The REDD1 antibody has been extensively tested and validated for its specificity and sensitivity, making it a reliable tool for researchers studying the role of REDD1 in different cellular processes.</p>

<p>Mouse monoclonal TMED1 antibody</p>

<p>Rabbit polyclonal TIMM9 antibody</p>

<p>This antibody reacts with heavy chains on human IgG (gamma chain).</p>

<p>The CD160 antibody is a monoclonal antibody that targets the CD160 protein, which is involved in immune response regulation. It acts as a colony-stimulating factor and plays a role in the activation of macrophages. The CD160 antibody has been extensively studied in the field of Life Sciences and has shown promising results in various experimental models. It has been shown to inhibit the activity of phosphatase enzymes and interfere with interferon signaling pathways. Additionally, it has been found to bind to glutamate receptors and modulate their function. The CD160 antibody is highly specific and exhibits strong binding affinity to its target. It can be used for various applications, including immunohistochemistry, flow cytometry, and Western blotting. This high-quality antibody is suitable for research purposes and is compatible with human serum samples.</p>

<p>EphB1 antibody was raised in Mouse using a purified recombinant fragment of EphB1(aa19-133) expressed in E. coli as the immunogen.</p>

<p>Rabbit polyclonal Tau antibody (Ser214)</p>

<p>Mouse monoclonal QPRT antibody</p>

<p>The NGAL antibody is a powerful multidrug antibody that has been specifically designed to target and neutralize activated antibodies in the body. This unique antibody has shown great potential in the field of Life Sciences, particularly in the development of monoclonal antibodies for therapeutic purposes. The NGAL antibody has been found to inhibit the activity of necrosis factor-related apoptosis-inducing antibodies, which are known to play a critical role in various diseases.</p>

<p>The GPR75 antibody is a powerful tool used in the field of life sciences. It specifically targets glucagon, a hormone involved in regulating glucose levels in the body. This antibody can be used for various applications, including immunohistochemistry, Western blotting, and ELISA assays.</p>

<p>Attractin antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>EBF3 antibody was raised in rabbit using the middle region of EBF3 as the immunogen</p>

<p>Mouse monoclonal MHC Class I antibody (allophycocyanin)</p>

<p>Rabbit polyclonal Raf1 antibody (Ser259)</p>

<p>FAK antibody was raised in Mouse using a purified recombinant fragment of human FAK expressed in E. coli as the immunogen.</p>

<p>Rat monoclonal 41BB Ligand antibody (PE)</p>

<p>The P54 antibody is a highly specialized protein that belongs to the family of kinase inhibitors. It is commonly used in Life Sciences research and has shown promising results in various studies. This polyclonal antibody specifically binds to proteins involved in the regulation of cell growth, such as epidermal growth factor (EGF) and androgen receptors.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of EIF4H antibody, catalog no. 70R-4728</p>

<p>The OR1D2 antibody is a highly specialized fibroin that exhibits cytotoxic properties. This antibody specifically targets TGF-beta, a key protein involved in various cellular processes. It also interacts with fibrinogen, a crucial protein for blood clotting. The OR1D2 antibody is available as both polyclonal and monoclonal antibodies, providing flexibility for different research needs. In addition, it has been shown to inhibit caspase-9 activity, an enzyme involved in apoptosis. Researchers in the life sciences field can utilize this antibody as a valuable tool for studying signal transduction pathways and family kinase inhibitors. Its immobilization capabilities make it ideal for binding proteins on surfaces or electrodes, facilitating various experimental setups.</p>

<p>OR13C9 antibody was raised in rabbit using the middle region of OR13C9 as the immunogen</p>

<p>ALDH6A1 antibody was raised using the middle region of ALDH6A1 corresponding to a region with amino acids AVLVGEAKKWLPELVEHAKNLRVNAGDQPGADLGPLITPQAKERVCNLID</p>

<p>TWEAK antibody was raised in goat using highly pure recombinant human TWEAK as the immunogen.</p>

<p>Psenen antibody was raised in rabbit using the N terminal of Psenen as the immunogen</p>

<p>Noggin antibody was raised in rabbit using a synthetic peptide comprising an internal sequence of the human Noggin protein as the immunogen.</p>

<p>HTR3A antibody was raised in rabbit using the middle region of HTR3A as the immunogen</p>

<p>The AK3 antibody is a nephrotoxic monoclonal antibody that is used in the field of Life Sciences. It has been extensively studied for its ability to detect protein biomarkers in various biological samples, including human serum. The AK3 antibody specifically targets histidine residues and can be used as a tool for the detection and quantification of proteins that contain this amino acid. It has also been shown to have inhibitory effects on epidermal growth factor and alpha-fetoprotein, making it a valuable tool for research in cancer biology. The AK3 antibody is commonly used in immunoassays and can be utilized with techniques such as carbon electrode-based assays or colloidal gold-based assays. Its high specificity and sensitivity make it an essential component in many research laboratories.</p>

<p>Rabbit polyclonal TEX12 antibody</p>

<p>Rabbit polyclonal RHOXF2 antibody</p>

<p>Purified recombinant Human CLTB protein (His tag)</p>

<p>This antibody reacts with heavy chains on human IgA (alpha chain) and.</p>

<p>NKIRAS1 antibody was raised using the N terminal of NKIRAS1 corresponding to a region with amino acids CETMEDVYMASVETDRGVKEQLHLYDTRGLQEGVELPKHYFSFADGFVLV</p>

<p>Thrombopoietin antibody was raised using a synthetic peptide corresponding to a region with amino acids HELLNGTRGLFPGPSRRTLGAPDISSGTSDTGSLPPNLQPGYSPSPTHPP</p>

<p>Rabbit polyclonal TNKS1BP1 antibody</p>

<p>Mouse monoclonal M-Ficolin antibody</p>

<p>PDE5A Antibody</p>

<p>IFN Alpha 7 antibody was raised using the N terminal of IFNA7 corresponding to a region with amino acids RALILLAQMGRISPFSCLKDRHEFRFPEEEFDGHQFQKTQAISVLHEMIQ</p>

<p>Recombinant Human IL13RA1 protein with His tag</p>

<p>GRWD1 antibody was raised in Rabbit using Human GRWD1 as the immunogen</p>

<p>The CDCP1 antibody is a growth factor that plays a crucial role in various cellular processes. It is an apical membrane protein and has been found to be a potential target for anti-CD20 antibodies. The CDCP1 antibody specifically recognizes and binds to the human folate receptor, inhibiting its activity. This monoclonal antibody has been extensively studied in the field of life sciences and has shown promising results as a therapeutic agent. Its unique glycosylation pattern allows for enhanced stability and efficacy. Additionally, the CDCP1 antibody has been found to activate signaling pathways involved in hepatocyte growth, making it a valuable tool for research in this area. With its high specificity and affinity towards its target antigen, this monoclonal antibody is a powerful tool for scientists and researchers alike.</p>

<p>Purified Polyclonal Cytochrome P450 3A4/5 antibody</p>

<p>Mouse monoclonal PPME1 antibody</p>

<p>NEU1 antibody was raised using a synthetic peptide corresponding to a region with amino acids VWSKDDGVSWSTPRNLSLDIGTEVFAPGPGSGIQKQREPRKGRLIVCGHG</p>

<p>The NF kappaB p65 antibody is a polyclonal antibody that specifically targets the protein NF kappaB p65. This antibody is widely used in life sciences research to study the role of NF kappaB p65 in various biological processes. NF kappaB p65 is a transcription factor that plays a crucial role in regulating gene expression. It forms a complex with other proteins and binds to specific DNA sequences, thereby controlling the transcription of target genes involved in immune response, inflammation, cell survival, and development.</p>

<p>Rat monoclonal B7DC antibody</p>

<p>DNA binding domain 39-147 amino acids: MRGSHHHHHH GMASMTGGQQ MGRDLYDDDD KDRWGSMPGG GGKAVAPSKQ SKKSSPMDRN SDEYRQRRER NNMAVKKSRL KSKQKAQDTL QRVNQLKEEN ERLEAKIKLL TKELSVLKDL FLEHAHNLAD NVQSISTENT TADGDN</p>

<p>PREB antibody was raised in rabbit using the N terminal of PREB as the immunogen</p>

<p>TPH2 antibody was raised using the N terminal of TPH2 corresponding to a region with amino acids REAATESGKTAVVFSLKNEVGGLVKALRLFQEKRVNMVHIESRKSRRRSS</p>