Prodotti biochimici e reagenti

<p>Portion of EBV</p>

<p>Shepherdin is an antagonist of the interaction between the apoptosis protein, survivin, and the molecular chaperone, heat shock protein 90 (Hsp90). The sequence of shepherdin corresponds to the site where Hsp90 binds to survivin. Shepherdin therefore has high affinity for Hsp90 and thus disrupts survivin binding and acts as an inhibitor of Hsp90 ATPase function by competing with ATP.The survivin-Hsp90 complex is a regulator of cell proliferation and cell viability in cancer tissue. Shepherdin has anti-cancer properties and can significantly suppress the growth of lung cancer cell lines and acute myeloid leukaemia (AML) by inducing apoptosis.</p>

<p>Cilengitide is a cyclic arginine-glycine-aspartic acid (RGD) motif containing peptide that selectively inhibits the integrin alphav subunit. Integrins are cell adhesion molecules which mediate cell-cell and cell-matrix interactions and creating a scaffold for tissue organisation. Integrins also act to regulate cell attachment, proliferation, differentiation, apoptosis and motility.Integrin alphav can form heterodimers with integrin subunits subunits β1, β3, β5, β6, or β8. Cilengitide is a highly specific antagonist of alphavβ3 and alphavβ5 integrins. It also and shows anti-angiogenic effects and inhibits growth and promotes apoptosis of tumour cells that express integrins, such as glioblastoma.Cilengitide has gone on to phase II trials for cancers such as glioblastoma, melanoma, prostate, breast, lung and head and neck cancers.</p>

<p>Fragment of the angiotensin-converting enzyme 2 (ACE2) peptidase domain (PD) alpha1 helix, a domain important for the interaction of ACE2 with the severe acute respiratory syndrome (SARS coronavirus receptor binding domain (SARS-CoV-2-RBD). SBP1 associates with the SARS-CoV-2-RBD with nanomolar affinity and can potentially block the key mechanism by which SARS CoV-2 initiates entry into human cells.</p>

<p>Peptide LCBiot-QYTSIHHGVVEVD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide LCBiot-ELSEALGQIFDSQR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Affinity chromatography and protein purification are more successful with highly selective ligands such as short peptides. Phage libraries have been utilised to identify novel peptides for target proteins. IgG1 monoclonal antibody is traditionally purified using protein A but is not ideal due to cost and methodology. EPIHRSTLTALL was found via phage library screening as the most selective ligand possible IgG1, and also highly stable. It binds to the constant region of IgG1 known as humanized anti-Tac (HAT). HAT is a humanized monoclonal antibody against the low-affinity p55 subunit of the interleukin IL-2 receptor.</p>

<p>Peptide Boc-VLK-pNA is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>CA 15-3 protein is a colloidal protein that plays a crucial role in various Life Sciences applications. It is associated with annexin A2 and is commonly used in research as a target for monoclonal antibodies. These neutralizing antibodies can be utilized to study the function of CA 15-3 protein and its interactions with other molecules, such as chemokines. In clinical settings, CA 15-3 protein has been found in pleural fluid and may serve as a potential biomarker for certain diseases, including cardiomyocyte dysfunction. Additionally, it has been observed to have natriuretic effects, suggesting its involvement in regulating fluid balance. Researchers often employ streptavidin-conjugated annexin A2 to detect activated forms of CA 15-3 protein. This allows for the visualization and quantification of this important biomolecule. Overall, CA 15-3 protein is an essential component in the field of Native Proteins &amp; Antigens research, providing</p>

<p>H-CGGVSAYLSRPSPFD-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-CGGVSAYLSRPSPFD-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-CGGVSAYLSRPSPFD-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-CGGVSAYLSRPSPFD-OH at the technical inquiry form on this page</p>

<p>VEGFR2 single chain antibody was raised in E.coli using Highly purified human sVEGFR-2/KDR as the immunogen.</p>

<p>Albumin (237-251) Bovine is derived from the globular protein Albumin and is found in the blood-plasma of humans (known as Human Serum Albumin, HSA) where it serves to maintain plasma pressure and nutritional balance. Another role it carries out is the transportation of bound molecules through the blood. Bovine serum albumin (BSA), composed of 583 amino acids, is very similar to HSA thus allowing BSA to be used as a successful model and a standard protein in laboratory experiments.Although BSA and HAS share homology in their three domains, I, II and III, BSA contains 2 tryptophan whereas HAS only contains 1 tryptophan residue.In agriculture the presence of the albumin protein has been used to assess the health of cows to ensure that a suitable quality of milk and meat are produced. Moreover it is important to detect bovine albumin in food and pharmaceutical products due to it being an allergenic protein.</p>

<p>Potent inverse agonist of peroxisome proliferator-activated receptor PPARβ and PPARδ with IC50 value of 27 nM. In mouse myoblasts, DG 172 enhanced recruitment of transcriptional corepressor and down-regulated transcription of PPARβ/δ target gene Angptl4. DG 172 also possess a PPARβ/δ-independent activity on bone marrow cells and promotes dendritic cell differentiation.</p>

<p>The hCG antibody is a monoclonal antibody that specifically targets and inhibits the activity of human chorionic gonadotropin (hCG). It binds to hCG, preventing it from interacting with its receptors and exerting its biological effects. This antibody has been widely used in research and diagnostic applications in the field of Life Sciences. It has been shown to inhibit the growth of cells that express high levels of c-myc or hepatocyte growth factor, suggesting its potential as a therapeutic agent for certain types of cancer. Additionally, this antibody can be used to detect and quantify hCG levels in various biological samples, making it valuable for pregnancy testing and monitoring. Its high specificity and affinity make it a reliable tool for scientists and clinicians working in the field of reproductive biology.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

Peptide H-FIIPQIVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Biotin-PEG2-Claudin-6 is derived from the tight junction protein Claudin-6 which is encoded by the CLDN6 gene and can be found within epithelial cell to cell contacts. The Claudin family are transmembrane proteins containing two extracellular loops and are involved in maintaining cell polarity and controlling paracellular ion flux.The expression of Claudin-6 is most commonly seen in early embryonic development where it plays a role in the regulation of blastocyst formation through tight junction enhancement. It is also an important factor for epidermal differentiation and barrier formation. Although it is more commonly seen in embryonic development it is also expressed in mammary epithelial cells. Studies have also shown Cldn6 to be a tumour suppressor in breast cancer.This peptide has a covalently bonded N-terminal Biotin tag that can be used for detection and purification and contains a polyethylene glycol spacer (PEG2).</p>

<p>Fluorogenic peptide substrate for flavivirus non-structural 3 (NS3) and non-structural 2B/3 (NS2B/3)- highly conserved serine proteases that performs several enzymatic functions critical for virus replication. The flaviviruses include: zika virus- west nile virus- dengue virus- yellow fever virus, and tick-borne encephalitis. Flaviviruses require proteolytic processing of polyprotein precursors to yield a functional viral particle. This processing is carried out by the two-component protease, consisting NS2B a small integral membrane protein, and NS3, a cytosolic protein. In its intact state this peptide is not fluorescent, however this substrate peptide is cleaved by NS3 or NS2B serine proteases in two successive steps to release Rhodamine 110. Upon rhodamine 110 fluorophore release fluorescence can then be detected. This peptide therefore allows for the quantification of NS3/ NS2B/3 serine protease activity. Rhodamine 110 is a widely used red fluorescent probe.</p>

<p>Peptide H-DAVEDLESVGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>CBL-B (98-109) is derived from the CBL-B E3 ubiquitin ligase which targets receptor tyrosine kinases to lysosome degradation. CBL-B and its family member CBL are expressed in hematopoietic cells and as E3 ubiquitin ligases they contain a tyrosine kinase domain and an RF domain joined by a linker domain. The function of the RF domain is to transfer ubiquitin from E2 ubiquitin-conjugating enzymes onto the target protein which is often phosphorylated. Consequently the ubiquitinated substrate, the receptor tyrosine kinases, are ultimately targeted to the lysosome for degradation. EGFR is an example of a receptor tyrosine kinase whose activation is prevented by CBL and CBL-B when they bind and recruit GRb2, the adapter protein to EGFR. Consequently the ubiquitinylation of EGFR occurs and targets it for recognition by the endosomal protein complex and then lysosome degradation.It has also been found that the CBL family can negatively regulate through ubiquitinylation, PI 3-kinases, Rap G-protein guanine nucleotide exchange factor (GEF), C3G and Rho GTPase GEF Vav which are all non-receptors.If CBL or CBL-B becomes non-functional it can be associated with malignancies such as acute myeloid leukemia and myelodysplastic syndrome.The lysine residue at position 11 is isotopically labelled with carbon-13 (6) and nitrogen-15 (2).</p>

<p>Peptide LCBiot-KKWKMRRNQFWVKVQRG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-YSSDYFQAPSDYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-SLDLDSIIAEVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>ANP (9-22) is derived from the atrial natriuretic peptide (ANP) which is a cardiac hormone involved in maintaining cardio-renal homeostasis. This occurs through the activation of the guanylyl cyclase-coupled receptor, resulting in the increased concentration of cyclic guanylate monophosphate. Moreover its function in the processes of anti-proliferation and anti-angiogenesis allow it to take part in the cardiovascular remodelling process.ANP is a member of the natriuretic peptide family and it is encoded by the NPPA gene, located on chromosome 1. Once synthesized from the 151 amino acid pre-prohormone into its biologically active form, ANP is secreted by the atrial cardiomyocytes in the circulating forms: ANP (1-98) and ANP (99-126). This synthesis process involves the signal peptide being removed from the pre-prohormone resulting in proANP (1-126) which is converted into the circulating forms by the type II transmembrane serine protease Corin.</p>

<p>Peptide H-EGVVAAAEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Inhibitor of protein kinase PKC</p>

<p>Peptide H-SLYASSPGGVYATR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

Peptide H-RPHFPQFSYSASGTA^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide Aoa-WLRKKACDVLEIPYVIKQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Thymosin β-4 (TB4) is an actin binding proteins (ABP), encoded by the TMSB4X gene and is regarded as the principal actin-sequestering protein in many cell types. TB4 is involved in maintaining sufficient amounts of intracellular monomeric actin that is readily available for use if needed. TB4 works by binding monomeric G-actin rendering it resistant to polymerisation into F-actin. TB4 is present in all cells except red blood cells and is located both in the cytoplasm and nucleus of the cell.TB4 is also involved in cell proliferation, migration, differentiation and tissue regeneration and may contribute to repair of human heart muscle damaged by heart disease and heart attack. TB4 reduces levels of inflammatory mediators, lowers reactive oxygen species, and up-regulates anti-oxidative enzymes, anti-inflammatory genes, and anti-apoptotic enzymes.The proline residue at position 4 of this peptide and the lysine residue at position 13 of this peptide are isotopically labelled with carbon-13 and nitrogen-15, giving this peptide a mass increase of 14 compared to the unlabelled peptide.</p>

<p>Peptide H-YRGITCSGRQK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-DTDSEEEIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-VTSAPDTRPAPGSTAPPAHG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide Myr-RIIDLLWRVRRPQKPKFVTVWVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Ara h 3 is one of the major allergenic proteins from peanut (Arachis hypogaea) which contains approximately 13 potential allergenic proteins. The Ara h 3 allergen is recognised by serum IgE from approximately 45% of peanut allergy patients. Ara h 3 belongs to the glycinin family of legume storage proteins (S11 plant storage proteins) and is extensively proteolytically processed.This peptide represents a tryptic peptide of Ara h 3. The leucine residue at position 6 of this peptide is isotopically labelled with carbon-13 (6) and nitrogen-15 (1), giving this peptide a mass increase of 7 compared to the unlabelled peptide.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-LQHLVNEL^THDIITK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H-ERFAVNPGL-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-ERFAVNPGL-OH is provided at greater that &gt;90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-ERFAVNPGL-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-ERFAVNPGL-OH at the technical inquiry form on this page</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

Peptide H-CGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Eosinophil major basic protein antibody was raised in mouse using human eosinophil major basic protein as the immunogen.</p>

Peptide H-SGAQATWTELPWPHEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-CGSDALDDFDLDML-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide Ac-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-FVNEEALR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide 5Azido-RKKRRQRRR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-YYGYTGAFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>This Rubella virus antigen has been sourced from the Rubella virus strain HPV-77, cultured in Vero cells (African Green Monkey Kidney) and inactivated by 0.02% SDS detergent treatment. It has been purified by ultracentrifugation and is presented as a purified antigen in approximately 20% sucrose / 0.02% SDS/ NTE buffer. Belonging to the Rubivirus genus, the Rubella virus is an airborne human pathogen which can cause mild symptoms similar to those seen in measles. However this positive-stranded RNA virus also has the potential to inflict more severe symptoms, for example in pregnant women the Rubella virus can cause congenital rubella syndrome which can result in hindered organ development.  CITES permit may be required for importation.Recommended by EDQM to pharmaceutical companies for Fc function test of injectable immunoglobin</p>