Prodotti biochimici e reagenti

<p>Syntide-2 is a substrate peptide which was specifically designed to be homologous to site 2 in glycogen synthase. Syntide-2 is therefore phosphorylated by Ca2+ calmodulin-dependent protein kinase II as well as other calcium dependant kinases and protein kinase C. Synthase-2 can also be phosphorylated by CAMP-dependent protein kinase and to a lesser extent- phosphorylase kinase, but not by myosin light chain kinase.</p>

<p>SARS-CoV-2 Membrane protein (172-188)</p>

<p>Peptide H-I^PGMVVDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>The Laminin antibody is a monoclonal antibody that specifically targets and binds to laminin, an essential protein found in the extracellular matrix. Laminin plays a crucial role in cell adhesion, migration, and tissue development. This antibody has been extensively tested and validated for its high specificity and sensitivity in various life science applications.</p>

<p>Peptide H-GLYASKLS-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Ubiquitin carboxyl-terminal hydrolase isozyme L1 (UCHL1) belongs to the peptidase C12 family. This enzyme is a thiol protease that hydrolyses peptide bonds at the C-terminal glycine of ubiquitin. The gene encoding the UCHL1 protein is specifically expressed in neurons and in cells of the diffuse neuroendocrine system. Mutations in the UCHL1 gene are often associated with Parkinson disease. Recent studies have linked UCHL1 expression and inflammation- inflammation regulates UCHL1 expression, and it is this regulatory mechanism that may be involved in the progression of Parkinson disease.</p>

<p>Peptide Ac-SNKYLDGNANKSTSDGSC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-PSEKTFKQRRTFEQC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>ANP (1-28) is derived from the atrial natriuretic peptide (ANP) which is a cardiac hormone involved in maintaining cardio-renal homeostasis. This occurs through the activation of the guanylyl cyclase-coupled receptor, resulting in the increased concentration of cyclic guanylate monophosphate. Moreover its function in the processes of anti-proliferation and anti-angiogenesis allow it to take part in cardiovascular remodelling.ANP is a member of the natriuretic peptide family and it is encoded by the NPPA gene, located on chromosome 1. Once synthesized from the 151 amino acid pre-prohormone into its biologically active form, ANP is secreted by the atrial cardiomyocytes in the circulating forms: ANP (1-98) and ANP (99-126). This synthesis process involves the signal peptide being removed from the pre-prohormone resulting in pro-ANP (1-126) which is converted into the circulating forms by the type II transmembrane serine protease Corin.</p>

<p>This sequence corresponds to the peptide bond between mammalian Lys11- (K11) linked Ub proteins- where (GG) corresponds to the C-terminus of the side chain appended Ub.Chains containing Lys11 (K11) Ub linkages are considered atypical. However they have been implicated in a range of cellular pathways. K11-Linked Ub, assembled via the ubiquitin ligase: anaphase-promoting complex/cyclosome (APC/C), regulate cell cycle progression via targeting proteins to the proteasome. K11 ubiquitin linkages are also involved in maintaining endoplasmic reticulum homeostasis and maintaining cellular protein homeostasis and have been discovered in protein aggregates found in neurodegenerative diseases, such as Alzheimer's disease and Huntington's disease.The C-terminal lysine residue of this peptide is isotopically labelled with carbon-13 (6) and nitrogen-15 (2), giving this peptide a mass increase of 8 compared to the unlabelled peptide.</p>

<p>Rabbit polyclonal PLCD4 antibody</p>

<p>Galanin (mouse, rat) is 29 amino acids, 1 less than human galanin. Galanin is a widely distributed neuropeptide in the central nervous, peripheral, and endocrine systems. Galanin interacts with 3 receptor subtypes, GalR1-3. These G protein-coupled receptors are inserted into the plasma membrane. Galanin has a role in energy homeostasis. Central injections of galanin to the amygdala lead to food intake in rats.Galanin has been shown to inhibit glutamate release from the hippocampus. Glutamate has an excitatory effect in the mechanisms of epileptic seizures- therefore, galanin is considered a possible anticonvulsant.  Galanin receptor agonists with anticonvulsant properties have been developed to help seizures. Galanin has also helped provide evidence of neuronal plasticity and degradation. Galanin has been used extensively for administration to animals in vivo including rats and mice to better understand its role and help treat appetite disorders.</p>

<p>ABCB4 antibody was raised using a synthetic peptide corresponding to a region with amino acids GRTCIVIAHRLSTIQNADLIVVFQNGRVKEHGTHQQLLAQKGIYFSMVSV</p>

<p>Anti-CYR61 antibody</p>

<p>P2-Hp-1935 is an antimicrobial peptide isolated from the skin secretions of the Montevideo tree frog (Hypsiboas pulchellus). P2-Hp-1935 displays activity against Gram positive and negative bacteria.</p>

<p>Peptide LCBiot-MPGERGAAGIAGPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-SFLVWVNEEDHLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-TDLHAFENLEIIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Human IgA1 protein is a glycoprotein that plays a crucial role in the immune system. It is a type of immunoglobulin that functions as an antibody, providing protection against pathogens and foreign substances. Human IgA1 protein has multiple characteristics and functions, including stimulating hepatocyte growth, acting as an electrode for cellular signaling, and interacting with androgens, collagens, inhibitors, monoclonal antibodies, and other binding proteins.</p>

<p>H-KINLKRAFS-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-KINLKRAFS-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-KINLKRAFS-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-KINLKRAFS-OH at the technical inquiry form on this page</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Ac-NYLFRPPPPYPRPE-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-NYLFRPPPPYPRPE-NH2 is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-NYLFRPPPPYPRPE-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-NYLFRPPPPYPRPE-NH2 at the technical inquiry form on this page</p>

Olanzapine is an antipsychotic drug present in formulations of certain medications used for the management of schizophrenia, bipolar disorder and agitation. This drug is an antagonist of 5-HT2A serotonin and dopamine (D1/2) receptors.

<p>Peptide H-GQTLLAVAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide derived from the gastrointestinal hormone Motilin, secreted from endocrine cells in the small intestines, mainly from the jejunum and duodenum, in response to the fasting, drinking water or the mechanical stimulus of eating.</p>

<p>Peptide substrate for the kallikrein-related peptidase 7 (KLK7), the most abundant KLK family protease in the stratum corneum (outermost layer of the epidermis). KLK family have been implicated in several key homeostatic processes and in skin diseases that feature impaired desquamation. Increased levels of KLK7, have been identified in the stratum corneum of patients with atopic dermatitis (AD). T-helper type 2 cytokines, including interleukin 4 (IL-4) and-IL-13, can stimulate expression of KLK7, suggesting a direct link between inflammation in AD and KLK7 levels.KLK7 cleaves its substrates after tyrosine or phenylalanine residues. This peptide contains a C-terminal 7-amino-4-methylcoumarin (AMC) fluorescent tag, which is quenched when linked to the peptide via the amide bond. AMC is cleaved from the peptide by KLK7, upon cleavage the AMC fluorescence is activated.</p>

<p>CD31 antibody was raised in mouse using lewis rat microglia as the immunogen.</p>

<p>ProBNP protein is a versatile product used in the field of Life Sciences. It is a protein that can be targeted with both polyclonal and monoclonal antibodies for various research purposes. The protein is commonly used in studies related to cardiomyocytes, as it plays a crucial role in cardiovascular health. ProBNP protein is also involved in the regulation of annexin, an inhibitory factor that affects cellular processes.</p>

<p>Residues 17-29 of the LL-37 peptide, also known as FK-13. FK-13 has near-similar anti-microbial and anti-cancer properties to LL-37. This core fragment also contains part of the LL-37 actin binding domain and can associate weakly with actin, actin binding protects this fragment from protease degradation.LL-37 is a member of the large cationic family of anti-microbial peptides called cathelicidins which have broad-spectrum anti-microbial activity and are expressed in many species. The only cathelicidin found in humans is LL-37- this is produced in epithelial cells, by proteolytic cleavage from the C-terminal of the hCAP-18 protein. LL-37 can be processed into several different forms of anti-microbial peptides. As well as its anti-microbial properties LL-37 also has anti-cancer properties and regulates many aspects of the innate immune system- overexpression of LL-37 has been linked to autoimmune diseases such as asthma and psoriasis.</p>

<p>Peptide LCBiot-TKKTLRT-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

The hCG alpha antibody is a highly reactive monoclonal antibody that is used in various applications in the field of Life Sciences. It can be used for ultrasensitive detection of human chorionic gonadotropin (hCG) in human serum, making it a valuable tool for pregnancy testing and fertility studies. The hCG alpha antibody is also commonly used in flow immunoassays and other diagnostic assays to detect the presence of hCG.

<p>Hemoglobin antibody was raised in mouse using purified human hemoglobin as the immunogen.</p>

<p>The Digoxigenin antibody is a powerful tool used in Life Sciences research. It is a monoclonal antibody that specifically binds to digoxigenin, a small molecule commonly used as a labeling reagent in molecular biology experiments. This antibody has been extensively validated for its high specificity and sensitivity in various applications.</p>

<p>Keratin-Derived anti-microbial Peptides (KDAMPs), are peptide fragment of the intermediate filament protein cytokeratin 6A. They were originally isolated from lysates of human corneal epithelial cells. KDAMPs exhibit coil structures with low α-helical content and are smaller and more stable than other known host-expressed anti-microbials.Multiple length KDAMPs have been studied for their anti-microbial properties, and different fragments show different anti-microbial spectrums. The 19 mer KDAMP peptide is rapidly bactericidal against multiple clinical isolates of Pseudomonas aeruginosa, and shows even greater activity against-Streptococcus pyogenes. However it is not active against Staphylococcus aureus-or-Escherichia coli.</p>

<p>H-DTRTYFTSATMIIAI-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-DTRTYFTSATMIIAI-OH is provided at greater that &gt;80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-DTRTYFTSATMIIAI-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-DTRTYFTSATMIIAI-OH at the technical inquiry form on this page</p>

<p>Peptide H-NKPGVYTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>hCG alpha antibody (HRP) was raised in mouse using hCG alpha subunit as the immunogen.</p>

<p>Sex Hormone-Binding Globulin (SHBG) is a glycoprotein that binds to sex hormones, primarily testosterone, dihydrotestosterone (DHT), and estradiol. This protein regulates the bioavailability of sex hormones in the bloodstream by controlling how much is free (active) versus bound (inactive). It plays a crucial role in hormone transport and regulation by carrying these hormones in the blood and influencing their activity in tissues. Higher SHBG levels result in less free testosterone and estrogen available for use, while lower SHBG levels increase the amount of free hormones, potentially amplifying their physiological effects. Clinically, elevated SHBG levels can lead to low free testosterone, causing symptoms such as fatigue, low libido, and muscle loss, whereas low SHBG levels are linked to conditions like insulin resistance, polycystic ovary syndrome (PCOS), obesity, and type 2 diabetes. Several factors influence SHBG levels, including estrogen, hyperthyroidism, liver disease, and pregnancy, which increase SHBG, while testosterone, insulin resistance, obesity, and hypothyroidism decrease it. SHBG is commonly measured in hormone panels to assess hormonal balance in both men and women.</p>

<p>Antibody that specifically targets thyroxine, a hormone produced by the thyroid gland.</p>

<p>Involucrin antibody (biotin) was raised in mouse using human keratinocytes’ involucrin as the immunogen.</p>

<p>Vimentin antibody (FITC) was raised in mouse using vimentin purified from bovine lens as the immunogen.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds known for their bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Extensive studies have shown its high activity on human erythrocytes using a patch-clamp technique. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth. Experience the potent effects of 6-Fluoro-3-indoxyl-beta-D-galactopyranoside for yourself</p>

<p>The dodecapeptide AR71 prevents melanoma inhibitory activity (MIA) dimerisation and hence inhibits (MIA). It therefore has the potential to be used as a therapeutic in melanoma.</p>

<p>H-VQVTEAK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-VQVTEAK-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-VQVTEAK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-VQVTEAK-OH at the technical inquiry form on this page</p>

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

<p>Cell-permeable calmodulin (CaM) agonist that binds to the EF-hand/Ca2+-binding site and can activate phosphodiesterase in the absence of Ca2+ and inhibit Ca2+ mediated cytotoxicity and apoptosis.</p>

<p>Myelin oligodendrocyte glycoprotein (MOG) is a member of the immunoglobulin (Ig) protein superfamily and is expressed exclusively in the central nervous system on the surface of myelin sheaths and oligodendrocyte processes. MOG is expressed at the onset of myelination, and therefore is a potential marker for oligodendrocyte maturation.MOG contains an extracellular domain, a transmembrane domain, a cytoplasmic loop, a membrane-associated region and a cytoplasmic tail.  MOG may function as a cell surface receptor or cell adhesion molecule.  Fifteen different alternatively spliced isoforms have been detected in humans. These are present either on the cell surface, the endoplasmic reticulum in the endocytic system, or in secreted form.The secreted form of MOG may trigger autoimmunity if released into the cerebrospinal fluid and periphery. MOG is thought to be a key target for autoantibodies and cell-mediated immune responses in inflammatory demyelinating diseases such as multiple sclerosis (MS) and is therefore widely studied in this field.The MOG (35-55) fragment is the most potent auto-antigenic region of MOG, and the most effective at inducing experimental autoimmune/allergic encephalomyelitis (EAE), an animal model that resembles MS. This peptide has a free carboxylic acid at the C-terminus, an amide version is also available in our catalogue.</p>

<p>Peptide H-HSVVVPYEPPEAGSEYTTIHYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Wilms tumor protein is a protein that is encoded by the WT1 gene on chromosome 11p in humans. WT1 is a tumour suppressor gene associated with the development of Wilms' Tumour, from which it was named. Mutations in exon 7 and 9 of WT1 have been recurrently identified in acute myeloid leukemia and associated with poorer prognosis and chemotherapy resistance.The WT1 peptide is a transcription factor that contains four zinc finger motifs at the C-terminus and a proline/glutamine-rich DNA-binding domain at the N-terminus. It has an essential role in the normal development of the urogenital system.WT1 has been ranked by the National Cancer Institute (NCI) as the Number 1 target for cancer immunotherapy.The arginine is isotopically labelled with carbon-13(6) and nitrogen-15(4).</p>

<p>Peptide H-NVTGFFQSLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>